Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ubiquitin carboxyl-terminal hydrolase isozyme L5 (UCHL5)

Recombinant Human Ubiquitin carboxyl-terminal hydrolase isozyme L5 (UCHL5) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Ubiquitin carboxyl-terminal hydrolase isozyme L5 (UCHL5) . Accession Number: Q9Y5K5; UCHL5. Expression Region: 1-326aa. Tag Info: N-terminal 6xHis-SUMO-tagged. Theoretical MW: 53.4kda. Target Synonyms: Ubiquitin C-terminal hydrolase UCH37Ubiquitin thioesterase L5 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Ubiquitin carboxyl-terminal hydrolase isozyme L5 (UCHL5) is a purified Recombinant Protein.

Accession Number

Q9Y5K5; UCHL5

Expression Region

1-326aa

Host

E. coli

Target

Ubiquitin carboxyl-terminal hydrolase isozyme L5 (UCHL5)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-SUMO-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Isoform 4

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

53.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Ubiquitin C-terminal hydrolase UCH37Ubiquitin thioesterase L5

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDTKTSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQLAEEPMDTDQGNSMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKFEKHFEKTLLGK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-TFDP2 antibody
SL7660R-01 50 µL

Rabbit Anti-TFDP2 antibody

Sign In for Pricing
View Details
Rabbit Anti-TFDP2 antibody
SL7660R-02 100 µL

Rabbit Anti-TFDP2 antibody

Sign In for Pricing
View Details
TSC2, Phosphorylated (Ser1798) (Tuberin, Tuberous Sclerosis 2 Protein, TSC4) (MaxLight 750)
MBS6503949-01 0.1 mL

TSC2, Phosphorylated (Ser1798) (Tuberin, Tuberous Sclerosis 2 Protein, TSC4) (MaxLight 750)

Sign In for Pricing
View Details
TSC2, Phosphorylated (Ser1798) (Tuberin, Tuberous Sclerosis 2 Protein, TSC4) (MaxLight 750)
MBS6503949-02 5x 0.1 mL

TSC2, Phosphorylated (Ser1798) (Tuberin, Tuberous Sclerosis 2 Protein, TSC4) (MaxLight 750)

Sign In for Pricing
View Details
Papolg sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4566805 3x 1.0 µg

Papolg sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Goose Bone Marrow Lymphocyte Isolation Solution Kit
P6080 200 mL/Kit

Goose Bone Marrow Lymphocyte Isolation Solution Kit

Sign In for Pricing
View Details