Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small proline-rich protein 3 (SPRR3)

Recombinant Human Small proline-rich protein 3 (SPRR3) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Small proline-rich protein 3 (SPRR3) . Accession Number: Q9UBC9; SPRR3. Expression Region: 2-169aa. Tag Info: N-terminal 6xHis-SUMO-tagged. Theoretical MW: 34kda. Target Synonyms: 22KDA pancornulin Cornifin beta Esophagin Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Small proline-rich protein 3 (SPRR3) is a purified Recombinant Protein.

Accession Number

Q9UBC9; SPRR3

Expression Region

2-169aa

Host

E. coli

Target

Small proline-rich protein 3 (SPRR3)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-SUMO-Tagged

Field of Research

Neuroscience

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

34kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

22KDA pancornulin Cornifin beta Esophagin

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

SSYQQKQTFTPPPQLQQQQVKQPSQPPPQEIFVPTTKEPCHSKVPQPGNTKIPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGYTKVPEPGSIKVPDQGFIKFPEPGAIKVPEQGYTKVPVPGYTKLPEPCPSTVTPGPAQQKTKQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Srgap2 AAV siRNA Pooled Vector
45454164 1.0 µg

Srgap2 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
PCDHB18 sgRNA CRISPR Lentivector (Human) (Target 1)
K1607002 1.0 µg DNA

PCDHB18 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Sox17 (14B13) Mouse Monoclonal antibody
E28PE4507 100 µL

Sox17 (14B13) Mouse Monoclonal antibody

Sign In for Pricing
View Details
Pantothenate Kinase 2, Mitochondrial, NT (Pantothenic Acid Kinase 2, PANK2, hPanK2, C20orf48, FLJ17232, HSS, HARP, MGC15053, NBIA1, PKAN) (APC)
MBS6491911-01 0.2 mL

Pantothenate Kinase 2, Mitochondrial, NT (Pantothenic Acid Kinase 2, PANK2, hPanK2, C20orf48, FLJ17232, HSS, HARP, MGC15053, NBIA1, PKAN) (APC)

Sign In for Pricing
View Details
Pantothenate Kinase 2, Mitochondrial, NT (Pantothenic Acid Kinase 2, PANK2, hPanK2, C20orf48, FLJ17232, HSS, HARP, MGC15053, NBIA1, PKAN) (APC)
MBS6491911-02 5x 0.2 mL

Pantothenate Kinase 2, Mitochondrial, NT (Pantothenic Acid Kinase 2, PANK2, hPanK2, C20orf48, FLJ17232, HSS, HARP, MGC15053, NBIA1, PKAN) (APC)

Sign In for Pricing
View Details
Recombinant Mouse DHRS7B Protein, His (Fc)-Avi-tagged
DHRS7B-2360M 50 µg

Recombinant Mouse DHRS7B Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details