Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Resistin (Retn)

Recombinant Mouse Resistin (Retn) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Resistin (Retn) . Accession Number: Q99P87; Retn. Expression Region: 21-114aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 14.2kda. Target Synonyms: Adipose tissue-specific secretory factor; ADSFAdipose-specific cysteine-rich secreted protein A12-alpha; Cysteine-rich secreted protein FIZZ3 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Resistin (Retn) is a purified Recombinant Protein.

Accession Number

Q99P87; Retn

Expression Region

21-114aa

Host

E. coli

Target

Resistin (Retn)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

14.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Adipose tissue-specific secretory factor; ADSFAdipose-specific cysteine-rich secreted protein A12-alpha; Cysteine-rich secreted protein FIZZ3

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

SSMPLCPIDEAIDKKIKQDFNSLFPNAIKNIGLNCWTVSSRGKLASCPEGTAVLSCSCGSACGSWDIREEKVCHCQCARIDWTAARCCKLQVAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse DnaJ homolog subfamily B member 14 (Dnajb14)
orb2925492-01 20 µg

Recombinant Mouse DnaJ homolog subfamily B member 14 (Dnajb14)

Sign In for Pricing
View Details
Recombinant Mouse DnaJ homolog subfamily B member 14 (Dnajb14)
orb2925492-02 100 µg

Recombinant Mouse DnaJ homolog subfamily B member 14 (Dnajb14)

Sign In for Pricing
View Details
Mouse Tnfrsf18 (NM_021985) AAV Particle
MR226360A1V 250 µL

Mouse Tnfrsf18 (NM_021985) AAV Particle

Sign In for Pricing
View Details
Histone H3 Polyclonal Antibody
BT-AP04097-01 20 µL

Histone H3 Polyclonal Antibody

Sign In for Pricing
View Details
Histone H3 Polyclonal Antibody
BT-AP04097-02 50 µL

Histone H3 Polyclonal Antibody

Sign In for Pricing
View Details
Histone H3 Polyclonal Antibody
BT-AP04097-03 100 µL

Histone H3 Polyclonal Antibody

Sign In for Pricing
View Details