Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Nucleoside diphosphate kinase, mitochondrial (NME4)

Recombinant Human Nucleoside diphosphate kinase, mitochondrial (NME4) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Nucleoside diphosphate kinase, mitochondrial (NME4) . Accession Number: O00746; NME4. Expression Region: 1-187aa. Tag Info: N-terminal GST-tagged. Theoretical MW: 44.3kda. Target Synonyms: Nucleoside diphosphate kinase D Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Nucleoside diphosphate kinase, mitochondrial (NME4) is a purified Recombinant Protein.

Accession Number

O00746; NME4

Expression Region

1-187aa

Host

E. coli

Target

Nucleoside diphosphate kinase, mitochondrial (NME4)

Conjugation

Unconjugated

Tag

N-Terminal GST-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

44.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Nucleoside diphosphate kinase D

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

SWTRERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVEGAQREIQLWFQSSELVSWADGGQHSSIHPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal eIF2B3 Antibody (OTI1A4) [Dylight 594]
NBP2-71397DL594 0.1 mL

Mouse Monoclonal eIF2B3 Antibody (OTI1A4) [Dylight 594]

Sign In for Pricing
View Details
NTS, 24-170aa, Human, His tag, E Coli (Denatured)
MBS205472-01 0.02 mg

NTS, 24-170aa, Human, His tag, E Coli (Denatured)

Sign In for Pricing
View Details
NTS, 24-170aa, Human, His tag, E Coli (Denatured)
MBS205472-02 0.1 mg

NTS, 24-170aa, Human, His tag, E Coli (Denatured)

Sign In for Pricing
View Details
NTS, 24-170aa, Human, His tag, E Coli (Denatured)
MBS205472-03 5x 0.02 mg

NTS, 24-170aa, Human, His tag, E Coli (Denatured)

Sign In for Pricing
View Details
NTS, 24-170aa, Human, His tag, E Coli (Denatured)
MBS205472-04 0.5 mg

NTS, 24-170aa, Human, His tag, E Coli (Denatured)

Sign In for Pricing
View Details
NTS, 24-170aa, Human, His tag, E Coli (Denatured)
MBS205472-05 5x 0.1 mg

NTS, 24-170aa, Human, His tag, E Coli (Denatured)

Sign In for Pricing
View Details