Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-1 alpha (IL1A)

Recombinant Human Interleukin-1 alpha (IL1A) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Interleukin-1 alpha (IL1A) . Accession Number: P01583; IL1A. Expression Region: 113-271aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 22kda. Target Synonyms: Hematopoietin-1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Interleukin-1 alpha (IL1A) is a purified Recombinant Protein.

Accession Number

P01583; IL1A

Expression Region

113-271aa

Host

E. coli

Target

Interleukin-1 alpha (IL1A)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

22kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Hematopoietin-1

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERI1, NT (ERI1, 3'EXO, THEX1, 3'-5' exoribonuclease 1, 3'-5' exonuclease ERI1, Eri-1 homolog, Histone mRNA 3'-end-specific exoribonuclease, Histone mRNA 3'-exonuclease 1, Protein 3'hExo) (Azide free) (HRP)
MBS6296518-01 0.2 mL

ERI1, NT (ERI1, 3'EXO, THEX1, 3'-5' exoribonuclease 1, 3'-5' exonuclease ERI1, Eri-1 homolog, Histone mRNA 3'-end-specific exoribonuclease, Histone mRNA 3'-exonuclease 1, Protein 3'hExo) (Azide free) (HRP)

Sign In for Pricing
View Details
ERI1, NT (ERI1, 3'EXO, THEX1, 3'-5' exoribonuclease 1, 3'-5' exonuclease ERI1, Eri-1 homolog, Histone mRNA 3'-end-specific exoribonuclease, Histone mRNA 3'-exonuclease 1, Protein 3'hExo) (Azide free) (HRP)
MBS6296518-02 5x 0.2 mL

ERI1, NT (ERI1, 3'EXO, THEX1, 3'-5' exoribonuclease 1, 3'-5' exonuclease ERI1, Eri-1 homolog, Histone mRNA 3'-end-specific exoribonuclease, Histone mRNA 3'-exonuclease 1, Protein 3'hExo) (Azide free) (HRP)

Sign In for Pricing
View Details
Rabbit Anti-Human Claudin-5 Polyclonal Antibody
PA83028HU-01 50 µg

Rabbit Anti-Human Claudin-5 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human Claudin-5 Polyclonal Antibody
PA83028HU-02 100 µg

Rabbit Anti-Human Claudin-5 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human Claudin-5 Polyclonal Antibody
PA83028HU-03 500 µg

Rabbit Anti-Human Claudin-5 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human Claudin-5 Polyclonal Antibody
PA83028HU-04 1 mg

Rabbit Anti-Human Claudin-5 Polyclonal Antibody

Sign In for Pricing
View Details