Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Eyes absent homolog 2 (EYA2)

Recombinant Human Eyes absent homolog 2 (EYA2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Eyes absent homolog 2 (EYA2) . Accession Number: O00167; EYA2. Expression Region: 1-514aa. Tag Info: N-terminal 6xHis-SUMO-tagged. Theoretical MW: 72.7kda. Target Synonyms: EAB 1; EAB1; EYA 2; EYA transcriptional coactivator and phosphatase 2; EYA2; EYA2_HUMAN; eyes absent 2 homolog (Drosophila) ; Eyes absent homolog 2 (Drosophila) ; Eyes absent homolog 2; Translation of this uORF probably lowers the translation efficiency of EYA2 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Eyes absent homolog 2 (EYA2) is a purified Recombinant Protein.

Accession Number

O00167; EYA2

Expression Region

1-514aa

Host

E. coli

Target

Eyes absent homolog 2 (EYA2)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-SUMO-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Isoform 2

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

72.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

EAB 1; EAB1; EYA 2; EYA transcriptional coactivator and phosphatase 2; EYA2; EYA2_HUMAN; eyes absent 2 homolog (Drosophila) ; Eyes absent homolog 2 (Drosophila) ; Eyes absent homolog 2; Translation of this uORF probably lowers the translation efficiency of EYA2

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MVELVISPSLTVNSDCLDKLKFNRADAAVWTLSDRQGITKSAPLRVSQLFSRSCPRVLPRQPSTAMAAYGQTQYSAGIQQATPYTAYPPPAQAYGIPSFSTSPTGQSPYTYQMHGTTGFYQGGNGLGNAAGFGSVHQDYPSYPGFPQSQYPQYYGSSYNPPYVPASSICPSPLSTSTYVLQEASHNVPNQSSESLAGEYNTHNGPSTPAKEGDTDRPHRASDGKLRGRSKRSSDPSPAGDNEIERVFVWDLDETIIIFHSLLTGTFASRYGKDTTTSVRIGLMMEEMIFNLADTHLFFNDLEDCDQIHVDDVSSDDNGQDLSTYNFSADGFHSSAPGANLCLGSGVHGGVDWMRKLAFRYRRVKEMYNTYKNNVGGLIGTPKRETWLQLRAELEALTDLWLTHSLKALNLINSRPNCVNVLVTTTQLIPALAKVLLYGLGSVFPIENIYSATKTGKESCFERIMQRFGRKAVYVVIGDGVEEEQGAKKHNMPFWRISCHADLEALRHALELEYL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Chemokine C-X3-C-Motif Ligand 1 CLIA Kit
MBS8426667-01 1 Kit

Rat Chemokine C-X3-C-Motif Ligand 1 CLIA Kit

Sign In for Pricing
View Details
Rat Chemokine C-X3-C-Motif Ligand 1 CLIA Kit
MBS8426667-02 5x 1 Kit

Rat Chemokine C-X3-C-Motif Ligand 1 CLIA Kit

Sign In for Pricing
View Details
ERK1/ERK2 Polyclonal Antibody
MBS2565734-01 0.06 mL

ERK1/ERK2 Polyclonal Antibody

Sign In for Pricing
View Details
ERK1/ERK2 Polyclonal Antibody
MBS2565734-02 0.12 mL

ERK1/ERK2 Polyclonal Antibody

Sign In for Pricing
View Details
ERK1/ERK2 Polyclonal Antibody
MBS2565734-03 0.2 mL

ERK1/ERK2 Polyclonal Antibody

Sign In for Pricing
View Details
ERK1/ERK2 Polyclonal Antibody
MBS2565734-04 5x 0.2 mL

ERK1/ERK2 Polyclonal Antibody

Sign In for Pricing
View Details