Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cathepsin L1 (Ctsl1), partial

Recombinant Mouse Cathepsin L1 (Ctsl1), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Cathepsin L1 (Ctsl1) . Accession Number: P06797; Ctsl. Expression Region: 114-288aa. Tag Info: N-terminal 6xHis-taggedand C-terminal Myc-tagged. Theoretical MW: 26.2kda. Target Synonyms: Cathepsin L; Major excreted protein; MEP; p39 cysteine proteinase; Ctsl1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Cathepsin L1 (Ctsl1), partial is a purified Recombinant Protein.

Accession Number

P06797; Ctsl

Expression Region

114-288aa

Host

E. coli

Target

Cathepsin L1 (Ctsl1)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Taggedand C-Terminal Myc-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

26.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Cathepsin L; Major excreted protein; MEP; p39 cysteine proteinase; Ctsl1

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

IPKSVDWREKGCVTPVKNQGQCGSCWAFSASGCLEGQMFLKTGKLISLSEQNLVDCSHAQGNQGCNGGLMDFAFQYIKENGGLDSEESYPYEAKDGSCKYRAEFAVANDTGFVDIPQQEKALMKAVATVGPISVAMDASHPSLQFYSSGIYYEPNCSSKNLDHGVLLVGYGYEGT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFNa1 (sifalimumab) discontinued, see 592195
047760 100 µg

IFNa1 (sifalimumab) discontinued, see 592195

Sign In for Pricing
View Details
Human MAB21L2 shRNA Plasmid
abx957204-01 150 µg

Human MAB21L2 shRNA Plasmid

Sign In for Pricing
View Details
Human MAB21L2 shRNA Plasmid
abx957204-02 300 µg

Human MAB21L2 shRNA Plasmid

Sign In for Pricing
View Details
Olr344 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV634274 1.0 µg DNA

Olr344 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Nck (NCK1) (NM_006153) Human Tagged Lenti ORF Clone
RC202869L3 10 µg

Nck (NCK1) (NM_006153) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Multi Fusion-Tagged recombinant Protein 58-Kda containing 17-tags (T-7, HSV, C-myc, VSV-G, Glu-Glu, V5, e-tag, GST, Flag, S-tag, HA, KT3, E2, Au1, Au5, 6xHis-tags) for ELISA
MFPM53-R-40 40 µg

Multi Fusion-Tagged recombinant Protein 58-Kda containing 17-tags (T-7, HSV, C-myc, VSV-G, Glu-Glu, V5, e-tag, GST, Flag, S-tag, HA, KT3, E2, Au1, Au5, 6xHis-tags) for ELISA

Sign In for Pricing
View Details