Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Clusterin (CLU)

Recombinant Human Clusterin (CLU) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Clusterin (CLU) . Accession Number: P10909; CLU. Expression Region: 23-449aa. Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged. Theoretical MW: 70.1kda. Target Synonyms: Aging-associated gene 4 protein Apolipoprotein J Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Clusterin (CLU) is a purified Recombinant Protein.

Accession Number

P10909; CLU

Expression Region

23-449aa

Host

E. coli

Target

Clusterin (CLU)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-SUMO-Tagged and C-Terminal Myc-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

70.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Aging-associated gene 4 protein Apolipoprotein J

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

DQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Tumor protein p53-inducible nuclear protein 1 (TP53INP1) ELISA Kit
RK12193 96 Tests

Human Tumor protein p53-inducible nuclear protein 1 (TP53INP1) ELISA Kit

Sign In for Pricing
View Details
KCNH2 Rabbit Polyclonal Antibody (Fluoro488)
orb3116865 100 µg

KCNH2 Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
RPL37AP3 3'UTR Luciferase Stable Cell Line
TU021540 1.0 mL

RPL37AP3 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Anti-EAAT1 Rabbit mAb
MBS8326873-01 0.03 mL

Recombinant Anti-EAAT1 Rabbit mAb

Sign In for Pricing
View Details
Recombinant Anti-EAAT1 Rabbit mAb
MBS8326873-02 0.05 mL

Recombinant Anti-EAAT1 Rabbit mAb

Sign In for Pricing
View Details
Recombinant Anti-EAAT1 Rabbit mAb
MBS8326873-03 0.1 mL

Recombinant Anti-EAAT1 Rabbit mAb

Sign In for Pricing
View Details