Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Clusterin (CLU)

Recombinant Human Clusterin (CLU) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Clusterin (CLU) . Accession Number: P10909; CLU. Expression Region: 23-449aa. Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged. Theoretical MW: 70.1kda. Target Synonyms: Aging-associated gene 4 protein Apolipoprotein J Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Clusterin (CLU) is a purified Recombinant Protein.

Accession Number

P10909; CLU

Expression Region

23-449aa

Host

E. coli

Target

Clusterin (CLU)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-SUMO-Tagged and C-Terminal Myc-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

70.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Aging-associated gene 4 protein Apolipoprotein J

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

DQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

APCDD1 Human shRNA Lentiviral Particle (Locus ID 147495)
TL306648V 500 µL Each

APCDD1 Human shRNA Lentiviral Particle (Locus ID 147495)

Sign In for Pricing
View Details
Recombinant Human Osteoprotegerin, His Tag
7-01324 10 µg

Recombinant Human Osteoprotegerin, His Tag

Sign In for Pricing
View Details
Bmp6 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3979603 1.0 µg DNA

Bmp6 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
VIM (Vimentin)
495409 100 µL

VIM (Vimentin)

Sign In for Pricing
View Details
SNX3P1X Adenovirus (Human)
45080051 1.0 mL

SNX3P1X Adenovirus (Human)

Sign In for Pricing
View Details
TOM1L1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
47281111 3x 1.0 µg

TOM1L1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details