Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Matrix metalloproteinase-20 (MMP20)

Recombinant Human Matrix metalloproteinase-20 (MMP20) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Matrix metalloproteinase-20 (MMP20) . Accession Number: O60882; MMP20. Expression Region: 108-483aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 46.4kda. Target Synonyms: Enamel metalloproteinase; Enamelysin; MMP-20 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Matrix metalloproteinase-20 (MMP20) is a purified Recombinant Protein.

Accession Number

O60882; MMP20

Expression Region

108-483aa

Host

Baculovirus

Target

Matrix metalloproteinase-20 (MMP20)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

46.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Enamel metalloproteinase; Enamelysin; MMP-20

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

YRLFPGEPKWKKNTLTYRISKYTPSMSSVEVDKAVEMALQAWSSAVPLSFVRINSGEADIMISFENGDHGDSYPFDGPRGTLAHAFAPGEGLGGDTHFDNAEKWTMGTNGFNLFTVAAHEFGHALGLAHSTDPSALMYPTYKYKNPYGFHLPKDDVKGIQALYGPRKVFLGKPTLPHAPHHKPSIPDLCDSSSSFDAVTMLGKELLLFKDRIFWRRQVHLRTGIRPSTITSSFPQLMSNVDAAYEVAERGTAYFFKGPHYWITRGFQMQGPPRTIYDFGFPRHVQQIDAAVYLREPQKTLFFVGDEYYSYDERKRKMEKDYPKNTEEEFSGVNGQIDAAVELNGYIYFFSGPKTYKYDTEKEDVVSVVKSSSWIGC

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GLIPR2 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-8411R-BF594 100 µL

GLIPR2 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
TrueNorth Cardboard Cryogenic Vial Boxes Type HS2860CB, blue PU= 12 pieces - Dimensions lxwxh: 133 x 133 x 50 mm
1217200 12 PCS/PCK

TrueNorth Cardboard Cryogenic Vial Boxes Type HS2860CB, blue PU= 12 pieces - Dimensions lxwxh: 133 x 133 x 50 mm

Sign In for Pricing
View Details
AIM2 Protein (N-His, Mus musculus (Mouse) )
P500376 100 µg

AIM2 Protein (N-His, Mus musculus (Mouse) )

Sign In for Pricing
View Details
Vmn2r122 Mouse siRNA Oligo Duplex (Locus ID 22308)
SR419717 1 Kit

Vmn2r122 Mouse siRNA Oligo Duplex (Locus ID 22308)

Sign In for Pricing
View Details
Mouse Monoclonal ESAM Antibody (1021723) [DyLight 755]
FAB42042Z 0.1 mL

Mouse Monoclonal ESAM Antibody (1021723) [DyLight 755]

Sign In for Pricing
View Details
Polyclonal Antibody to S100 Calcium Binding Protein B (S100B)
MBS2006364-01 0.1 mL

Polyclonal Antibody to S100 Calcium Binding Protein B (S100B)

Sign In for Pricing
View Details