Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cytochrome c oxidase subunit 5A, mitochondrial (COX5A)

Recombinant Human Cytochrome c oxidase subunit 5A, mitochondrial (COX5A) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Cytochrome c oxidase subunit 5A, mitochondrial (COX5A) . Accession Number: P20674; COX5A. Expression Region: 42-150aa. Tag Info: N-terminal GST-tagged. Theoretical MW: 39.5kda. Target Synonyms: Cytochrome c oxidase polypeptide Va Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Cytochrome c oxidase subunit 5A, mitochondrial (COX5A) is a purified Recombinant Protein.

Accession Number

P20674; COX5A

Expression Region

42-150aa

Host

E. coli

Target

Cytochrome c oxidase subunit 5A, mitochondrial (COX5A)

Conjugation

Unconjugated

Tag

N-Terminal GST-Tagged

Field of Research

Metabolism

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

39.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Cytochrome c oxidase polypeptide Va

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

SHGSQETDEEFDARWVTYFNKPDIDAWELRKGINTLVTYDMVPEPKIIDAALRACRRLNDFASTVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-Smad3  (Ser208)  Antibody
ABF3365 100 µg

Phospho-Smad3 (Ser208) Antibody

Sign In for Pricing
View Details
XRCC3 (X-ray Repair Cross-complementing Protein 3, CMM6) discontinued
214193-01 20 µL

XRCC3 (X-ray Repair Cross-complementing Protein 3, CMM6) discontinued

Sign In for Pricing
View Details
XRCC3 (X-ray Repair Cross-complementing Protein 3, CMM6) discontinued
214193-02 100 µL

XRCC3 (X-ray Repair Cross-complementing Protein 3, CMM6) discontinued

Sign In for Pricing
View Details
C10orf11 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0274508 1.0 µg DNA

C10orf11 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Lcn9 (NM_029959) Mouse Tagged ORF Clone
MG220193 10 µg

Lcn9 (NM_029959) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Rabbit Anti-Human ITCH mAb
MA1290-01 50 μL

Rabbit Anti-Human ITCH mAb

Sign In for Pricing
View Details