Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cytochrome c oxidase subunit 5A, mitochondrial (COX5A)

Recombinant Human Cytochrome c oxidase subunit 5A, mitochondrial (COX5A) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Cytochrome c oxidase subunit 5A, mitochondrial (COX5A) . Accession Number: P20674; COX5A. Expression Region: 42-150aa. Tag Info: N-terminal GST-tagged. Theoretical MW: 39.5kda. Target Synonyms: Cytochrome c oxidase polypeptide Va Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Cytochrome c oxidase subunit 5A, mitochondrial (COX5A) is a purified Recombinant Protein.

Accession Number

P20674; COX5A

Expression Region

42-150aa

Host

E. coli

Target

Cytochrome c oxidase subunit 5A, mitochondrial (COX5A)

Conjugation

Unconjugated

Tag

N-Terminal GST-Tagged

Field of Research

Metabolism

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

39.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Cytochrome c oxidase polypeptide Va

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

SHGSQETDEEFDARWVTYFNKPDIDAWELRKGINTLVTYDMVPEPKIIDAALRACRRLNDFASTVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human CDHR1 shRNA (UAS) - Lentiviral human CDHR1 shRNA (UAS) (25)
GTR15115613 1 Vial

Lentiviral human CDHR1 shRNA (UAS) - Lentiviral human CDHR1 shRNA (UAS) (25)

Sign In for Pricing
View Details
C9orf35 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV720143 1.0 µg DNA

C9orf35 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Mouse Transmembrane protein 190, Tmem190 ELISA KIT
ELI-22931m 96 Tests

Mouse Transmembrane protein 190, Tmem190 ELISA KIT

Sign In for Pricing
View Details
Rabbit Polyclonal ATG16L1 Antibody [DyLight 350]
NB110-82384UV 0.1 mL

Rabbit Polyclonal ATG16L1 Antibody [DyLight 350]

Sign In for Pricing
View Details
RSU1 (Ras Suppressor Protein 1, FLJ31034, RSP-1) (MaxLight 490)
MBS6208392-01 0.1 mL

RSU1 (Ras Suppressor Protein 1, FLJ31034, RSP-1) (MaxLight 490)

Sign In for Pricing
View Details
RSU1 (Ras Suppressor Protein 1, FLJ31034, RSP-1) (MaxLight 490)
MBS6208392-02 5x 0.1 mL

RSU1 (Ras Suppressor Protein 1, FLJ31034, RSP-1) (MaxLight 490)

Sign In for Pricing
View Details