Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 (SVEP1), partial

Recombinant Human Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 (SVEP1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 (SVEP1) . Accession Number: Q4LDE5; SVEP1. Expression Region: 736-827aa. Tag Info: C-terminal hFc-tagged. Theoretical MW: 39.5kda. Target Synonyms: CCP module-containing protein 22; Polydom; Selectin-like osteoblast-derived protein; SEL-OB; Serologically defined breast cancer antigen NY-BR-38 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 (SVEP1), partial is a purified Recombinant Protein.

Accession Number

Q4LDE5; SVEP1

Expression Region

736-827aa

Host

Mammalian Cells

Target

Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 (SVEP1)

Conjugation

Unconjugated

Tag

C-Terminal hFc-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

39.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

CCP module-containing protein 22; Polydom; Selectin-like osteoblast-derived protein; SEL-OB; Serologically defined breast cancer antigen NY-BR-38

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

GDFICTPDNTGVNCTLTCLEGYDFTEGSTDKYYCAYEDGVWKPTYTTEWPDCAKKRFANHGFKSFEMFYKAARCDDTDLMKKFSEAFETTLG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CEACAM8 Pre-designed siRNA Set A
SI002767A 1 Each

Human CEACAM8 Pre-designed siRNA Set A

Request Quote
View Details
USP9X (Ubiquitin Specific Peptidase 9, X-Linked, DFFRX, FAF, FAM)
253337 100 µg

USP9X (Ubiquitin Specific Peptidase 9, X-Linked, DFFRX, FAF, FAM)

Request Quote
View Details
FAM76B (NM_144664) Human Tagged Lenti ORF Clone
RC206138L3 10 µg

FAM76B (NM_144664) Human Tagged Lenti ORF Clone

Request Quote
View Details
HRP-Linked Polyclonal Antibody to Agouti Related Protein (AGRP)
MBS2053651-01 0.1 mL

HRP-Linked Polyclonal Antibody to Agouti Related Protein (AGRP)

Request Quote
View Details
HRP-Linked Polyclonal Antibody to Agouti Related Protein (AGRP)
MBS2053651-02 0.2 mL

HRP-Linked Polyclonal Antibody to Agouti Related Protein (AGRP)

Request Quote
View Details
HRP-Linked Polyclonal Antibody to Agouti Related Protein (AGRP)
MBS2053651-03 0.5 mL

HRP-Linked Polyclonal Antibody to Agouti Related Protein (AGRP)

Request Quote
View Details