Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Enhancer of yellow 2 transcription factor homolog (ENY2)

Recombinant Human Enhancer of yellow 2 transcription factor homolog (ENY2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Enhancer of yellow 2 transcription factor homolog (ENY2) . Accession Number: Q9NPA8; ENY2. Expression Region: 1-101aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 18.4kda. Target Synonyms: Enhancer of yellow 2 transcription factor homolog Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Enhancer of yellow 2 transcription factor homolog (ENY2) is a purified Recombinant Protein.

Accession Number

Q9NPA8; ENY2

Expression Region

1-101aa

Host

E. coli

Target

Enhancer of yellow 2 transcription factor homolog (ENY2)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Cell Biology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

18.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Enhancer of yellow 2 transcription factor homolog

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MVVSKMNKDAQMRAAINQKLIETGERERLKELLRAKLIECGWKDQLKAHCKEVIKEKGLEHVTVDDLVAEITPKGRALVPDSVKKELLQRIRTFLAQHASL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Ccnq qPCR Primer Pair
QM37194S 200 Tests

Mouse Ccnq qPCR Primer Pair

Sign In for Pricing
View Details
PRTFDC1, CT (PRTFDC1, HHGP, Phosphoribosyltransferase domain-containing protein 1)
040531 200 µL

PRTFDC1, CT (PRTFDC1, HHGP, Phosphoribosyltransferase domain-containing protein 1)

Sign In for Pricing
View Details
Pentanedioic-d6 Anhydride
G598071 10 mg

Pentanedioic-d6 Anhydride

Sign In for Pricing
View Details
A2B receptor antagonist 2
MBS5785270 Inquire

A2B receptor antagonist 2

Sign In for Pricing
View Details
AGAP4 (Arf-GAP with GTPase, ANK Repeat and PH Domain-Containing Protein 4)
474879 100 µL

AGAP4 (Arf-GAP with GTPase, ANK Repeat and PH Domain-Containing Protein 4)

Sign In for Pricing
View Details
Benzyl 2-acetamido-2-deoxy-β-D-glucopyranoside
GC3420-5g 5 g

Benzyl 2-acetamido-2-deoxy-β-D-glucopyranoside

Sign In for Pricing
View Details