Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Guanine nucleotide-binding protein G (I) /G (S) /G (O) subunit gamma-12 (Gng12)

Recombinant Mouse Guanine nucleotide-binding protein G (I) /G (S) /G (O) subunit gamma-12 (Gng12) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Guanine nucleotide-binding protein G (I) /G (S) /G (O) subunit gamma-12 (Gng12) . Accession Number: Q9DAS9; Gng12. Expression Region: 2-69aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 15.0kda. Target Synonyms: Guanine nucleotide-binding protein G (I) /G (S) /G (O) subunit gamma-12 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Guanine nucleotide-binding protein G (I) /G (S) /G (O) subunit gamma-12 (Gng12) is a purified Recombinant Protein.

Accession Number

Q9DAS9; Gng12

Expression Region

2-69aa

Host

E. coli

Target

Guanine nucleotide-binding protein G (I) /G (S) /G (O) subunit gamma-12 (Gng12)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

15.0kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Guanine nucleotide-binding protein G (I) /G (S) /G (O) subunit gamma-12

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

SSKTASTNSIAQARRTVQQLRLEASIERIKVSKASADLMSYCEEHARSDPLLMGIPTSENPFKDKKTC

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

WDR26 Antibody
KC-37060-01 50 μL

WDR26 Antibody

Sign In for Pricing
View Details
WDR26 Antibody
KC-37060-02 100 µL

WDR26 Antibody

Sign In for Pricing
View Details
WDR26 Antibody
KC-37060-03 1 mL

WDR26 Antibody

Sign In for Pricing
View Details
Chicken Zinc Finger Protein Eos (IKZF4) ELISA Kit
MBS9940589 Inquire

Chicken Zinc Finger Protein Eos (IKZF4) ELISA Kit

Sign In for Pricing
View Details
Rheostats, Sliding Contact, Open Type, Single Tube
1090980/2E 1 Each

Rheostats, Sliding Contact, Open Type, Single Tube

Sign In for Pricing
View Details
SNX5 3'UTR Luciferase Stable Cell Line
TU024269 1.0 mL

SNX5 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details