Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pan troglodytes Lymphotoxin-beta (LTB), partial

Recombinant Pan troglodytes Lymphotoxin-beta (LTB), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Pan troglodytes (Chimpanzee) . Target Name: Lymphotoxin-beta (LTB) . Accession Number: Q862Z7; LTB. Expression Region: 49-244aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 24.8kda. Target Synonyms: Tumor necrosis factor C; TNF-CTumor necrosis factor ligand superfamily member 3 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Pan troglodytes Lymphotoxin-beta (LTB), partial is a purified Recombinant Protein.

Accession Number

Q862Z7; LTB

Expression Region

49-244aa

Host

E. coli

Target

Lymphotoxin-beta (LTB)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Extracellular Domain

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

24.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Tumor necrosis factor C; TNF-CTumor necrosis factor ligand superfamily member 3

Species

Pan troglodytes (Chimpanzee)

Protein Name

Recombinant Protein

AA Sequence

QDQGGLVTETADPGAQAQQGLGFQKLPEEEPETDLSPGLPAAHLIGAPLKGQGLGWETTKEQAFLTSGTQFSDAEGLALPQDGLYYLYCLVGYRGRTPPGGGDPQGRSVTLRSSLYRAGGAYGPGTPELLLEGAETVTPVLDPARRQGYGPLWYTSVGFGGLVQLRRGERVYVNISHPDMVDFARGKTFFGAVMVG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vildagliptin dihydrate 25mg
A21898-25 25 mg

Vildagliptin dihydrate 25mg

Sign In for Pricing
View Details
FITC-Linked Anti-S100 Calcium Binding Protein (S100)
FY-AB44045-01 1 mL

FITC-Linked Anti-S100 Calcium Binding Protein (S100)

Sign In for Pricing
View Details
FITC-Linked Anti-S100 Calcium Binding Protein (S100)
FY-AB44045-02 100 µL

FITC-Linked Anti-S100 Calcium Binding Protein (S100)

Sign In for Pricing
View Details
FITC-Linked Anti-S100 Calcium Binding Protein (S100)
FY-AB44045-03 200 µL

FITC-Linked Anti-S100 Calcium Binding Protein (S100)

Sign In for Pricing
View Details
HydroxyacylGlutathione hydrolase mitochondrial (HAGH) Bovine ELISA Kit
E1520 96 Tests

HydroxyacylGlutathione hydrolase mitochondrial (HAGH) Bovine ELISA Kit

Sign In for Pricing
View Details
TBCA, ID (TBCA, Tubulin-specific chaperone A, TCP1-chaperonin cofactor A, Tubulin-folding cofactor A)
042643 200 µL

TBCA, ID (TBCA, Tubulin-specific chaperone A, TCP1-chaperonin cofactor A, Tubulin-folding cofactor A)

Sign In for Pricing
View Details