Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Kita-kyushu lung cancer antigen 1 (CT83), partial

Recombinant Human Kita-kyushu lung cancer antigen 1 (CT83), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Kita-kyushu lung cancer antigen 1 (CT83) . Accession Number: Q5H943; CT83. Expression Region: 22-113aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 11.2kda. Target Synonyms: Cancer/testis antigen 83 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Kita-kyushu lung cancer antigen 1 (CT83), partial is a purified Recombinant Protein.

Accession Number

Q5H943; CT83

Expression Region

22-113aa

Host

E. coli

Target

Kita-kyushu lung cancer antigen 1 (CT83)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

11.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Cancer/testis antigen 83

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

RRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL13P6 3'UTR Lenti-reporter-Luc Vector
40839081 1.0 µg

RPL13P6 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Recombinant Human TGF-beta 3 (CHO-expressed) Protein CF
8420-B3-100/CF 100 µg

Recombinant Human TGF-beta 3 (CHO-expressed) Protein CF

Sign In for Pricing
View Details
Dog/Canine Protein Kinase N1 PKN1 ELISA Kit
BG-CAN11835 1 Each

Dog/Canine Protein Kinase N1 PKN1 ELISA Kit

Sign In for Pricing
View Details
Rabbit anti-human Kinesin-like protein KIF2C polyclonal Antibody(KIF2C)
MBS1495485-01 0.05 mL

Rabbit anti-human Kinesin-like protein KIF2C polyclonal Antibody(KIF2C)

Sign In for Pricing
View Details
Rabbit anti-human Kinesin-like protein KIF2C polyclonal Antibody(KIF2C)
MBS1495485-02 0.1 mL

Rabbit anti-human Kinesin-like protein KIF2C polyclonal Antibody(KIF2C)

Sign In for Pricing
View Details
Rabbit anti-human Kinesin-like protein KIF2C polyclonal Antibody(KIF2C)
MBS1495485-03 5x 0.1 mL

Rabbit anti-human Kinesin-like protein KIF2C polyclonal Antibody(KIF2C)

Sign In for Pricing
View Details