Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Choline transporter-like protein 4 (SLC44A4), partial

Recombinant Human Choline transporter-like protein 4 (SLC44A4), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Choline transporter-like protein 4 (SLC44A4) . Accession Number: Q53GD3; SLC44A4. Expression Region: 56-229aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 26.7kda. Target Synonyms: Solute carrier family 44 member 4; Thiamine pyrophosphate transporter 1; hTPPT1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Choline transporter-like protein 4 (SLC44A4), partial is a purified Recombinant Protein.

Accession Number

Q53GD3; SLC44A4

Expression Region

56-229aa

Host

E. coli

Target

Choline transporter-like protein 4 (SLC44A4)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

26.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Solute carrier family 44 member 4; Thiamine pyrophosphate transporter 1; hTPPT1

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

WLYGDPRQVLYPRNSTGAYCGMGENKDKPYLLYFNIFSCILSSNIISVAENGLQCPTPQVCVSSCPEDPWTVGKNEFSQTVGEVFYTKNRNFCLPGVPWNMTVITSLQQELCPSFLLPSAPALGRCFPWTNVTPPALPGITNDTTIQQGISGLIDSLNARDISVKIFEDFAQSW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(1-Methoxycyclohexyl) methanol
SEA63711-01 50 mg

(1-Methoxycyclohexyl) methanol

Sign In for Pricing
View Details
(1-Methoxycyclohexyl) methanol
SEA63711-02 0.5 g

(1-Methoxycyclohexyl) methanol

Sign In for Pricing
View Details
Anti-Human RPL17 Polyclonal Antibody
PHD30301 100 μg

Anti-Human RPL17 Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse Ccnf shRNA (UAS) - Lentiviral mouse Ccnf shRNA (UAS, iRFP) (25)
GTR15191342 1 Vial

Lentiviral mouse Ccnf shRNA (UAS) - Lentiviral mouse Ccnf shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
H SKIV2L Expression Lentivirus
LVP919-GP 1x 10^7 IFU/mL - 200 μL

H SKIV2L Expression Lentivirus

Sign In for Pricing
View Details
HP-1alpha Mouse Monoclonal Antibody (2G2)
MBS8594809-01 0.1 mg

HP-1alpha Mouse Monoclonal Antibody (2G2)

Sign In for Pricing
View Details