Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shigella dysenteriae serotype 1 Shiga toxin subunit B (stxB)

Recombinant Shigella dysenteriae serotype 1 Shiga toxin subunit B (stxB) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Shigella dysenteriae serotype 1 (strain Sd197) . Target Name: Shiga toxin subunit B (stxB) . Accession Number: Q32GM0; stxB. Expression Region: 21-89aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 15.1kda. Target Synonyms: stxB; SDY_1390; Shiga toxin subunit B Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Shigella dysenteriae serotype 1 Shiga toxin subunit B (stxB) is a purified Recombinant Protein.

Accession Number

Q32GM0; stxB

Expression Region

21-89aa

Host

E. coli

Target

Shiga toxin subunit B (stxB)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

15.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

StxB; SDY_1390; Shiga toxin subunit B

Species

Shigella dysenteriae serotype 1 (strain Sd197)

Protein Name

Recombinant Protein

AA Sequence

TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Amorolfine Impurity 24
RM-A132624-01 10 mg

Amorolfine Impurity 24

Sign In for Pricing
View Details
Amorolfine Impurity 24
RM-A132624-02 25 mg

Amorolfine Impurity 24

Sign In for Pricing
View Details
Amorolfine Impurity 24
RM-A132624-03 50 mg

Amorolfine Impurity 24

Sign In for Pricing
View Details
Amorolfine Impurity 24
RM-A132624-04 100 mg

Amorolfine Impurity 24

Sign In for Pricing
View Details
Dog/Canine Galanin Receptor 1 GALR1 ELISA Kit
BG-CAN11070 1 Each

Dog/Canine Galanin Receptor 1 GALR1 ELISA Kit

Sign In for Pricing
View Details
Anti-MYBPC2 Antibody
A14099 0.1 mg

Anti-MYBPC2 Antibody

Sign In for Pricing
View Details