Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shigella dysenteriae serotype 1 Shiga toxin subunit B (stxB)

Recombinant Shigella dysenteriae serotype 1 Shiga toxin subunit B (stxB) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Shigella dysenteriae serotype 1 (strain Sd197) . Target Name: Shiga toxin subunit B (stxB) . Accession Number: Q32GM0; stxB. Expression Region: 21-89aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 15.1kda. Target Synonyms: stxB; SDY_1390; Shiga toxin subunit B Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Shigella dysenteriae serotype 1 Shiga toxin subunit B (stxB) is a purified Recombinant Protein.

Accession Number

Q32GM0; stxB

Expression Region

21-89aa

Host

E. coli

Target

Shiga toxin subunit B (stxB)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

15.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

StxB; SDY_1390; Shiga toxin subunit B

Species

Shigella dysenteriae serotype 1 (strain Sd197)

Protein Name

Recombinant Protein

AA Sequence

TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TXNIP antibody
FNab09129 100 µg

TXNIP antibody

Sign In for Pricing
View Details
iFluor™ 488 Conjugated Goat anti-rabbit IgG Goat Polyclonal Antibody (HA1121)
HA1121 100 µL

iFluor™ 488 Conjugated Goat anti-rabbit IgG Goat Polyclonal Antibody (HA1121)

Sign In for Pricing
View Details
Sdccag3 3'UTR Lenti-reporter-Luc Vector
43241086 1.0 µg

Sdccag3 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
OPCML Antibody, FITC conjugated
A55466-100UL 100 µL

OPCML Antibody, FITC conjugated

Sign In for Pricing
View Details
Recombinant Aedes aegypti NADH-ubiquinone oxidoreductase chain 4L (mt:ND4L), partial
MBS7056283 Inquire

Recombinant Aedes aegypti NADH-ubiquinone oxidoreductase chain 4L (mt:ND4L), partial

Sign In for Pricing
View Details
Anti-Irisin Polyclonal Antibody
MF-0078402-01 50 µL

Anti-Irisin Polyclonal Antibody

Sign In for Pricing
View Details