Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Splicing factor 3B subunit 3 (SF3B3; T899I), partial

Recombinant Human Splicing factor 3B subunit 3 (SF3B3; T899I), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Splicing factor 3B subunit 3 (SF3B3; T899I) . Accession Number: Q15393; SF3B3. Expression Region: 819-1217aa (T899I) . Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 52.1kda. Target Synonyms: Pre-mRNA-splicing factor SF3b 130 kDa subunit; SF3b130; STAF130; Spliceosome-associated protein 130; SAP 130 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Splicing factor 3B subunit 3 (SF3B3; T899I), partial is a purified Recombinant Protein.

Accession Number

Q15393; SF3B3

Expression Region

819-1217aa (T899I)

Host

E. coli

Target

Splicing factor 3B subunit 3 (SF3B3; T899I)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

52.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Pre-mRNA-splicing factor SF3b 130 kDa subunit; SF3b130; STAF130; Spliceosome-associated protein 130; SAP 130

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MAEEMVEAAGEDERELAAEMAAAFLNENLPESIFGAPKAGNGQWASVIRVMNPIQGNTLDLVQLEQNEAAFSVAVCRFSNIGEDWYVLVGVAKDLILNPRSVAGGFVYTYKLVNNGEKLEFLHKTPVEEVPAAIAPFQGRVLIGVGKLLRVYDLGKKKLLRKCENKHIANYISGIQTIGHRVIVSDVQESFIWVRYKRNENQLIIFADDTYPRWVTTASLLDYDTVAGADKFGNICVVRLPPNTNDEVDEDPTGNKALWDRGLLNGASQKAEVIMNYHVGETVLSLQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDFFQHVEMHLRSEHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPNKQKNVSEELDRTPPEVSKKLEDIRTRYAF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIMM9 Protein Vector (Mouse) (pPM-C-HA)
PV238412 500 ng

TIMM9 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Bcl10 Antibody
R31853 100 µg

Bcl10 Antibody

Sign In for Pricing
View Details
Human RFC1 qPCR Primer Pair
QH21553S 200 Tests

Human RFC1 qPCR Primer Pair

Sign In for Pricing
View Details
DNMT3A (NM_022552) Human Tagged ORF Clone Lentiviral Particle
RC213064L3V 200 µL

DNMT3A (NM_022552) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
PON2, ID (PON2, Serum paraoxonase/arylesterase 2, Aromatic esterase 2, Serum aryldialkylphosphatase 2) (MaxLight 490)
MBS6335890-01 0.1 mL

PON2, ID (PON2, Serum paraoxonase/arylesterase 2, Aromatic esterase 2, Serum aryldialkylphosphatase 2) (MaxLight 490)

Sign In for Pricing
View Details
PON2, ID (PON2, Serum paraoxonase/arylesterase 2, Aromatic esterase 2, Serum aryldialkylphosphatase 2) (MaxLight 490)
MBS6335890-02 5x 0.1 mL

PON2, ID (PON2, Serum paraoxonase/arylesterase 2, Aromatic esterase 2, Serum aryldialkylphosphatase 2) (MaxLight 490)

Sign In for Pricing
View Details