Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Splicing factor 3B subunit 3 (SF3B3; T899I), partial

Recombinant Human Splicing factor 3B subunit 3 (SF3B3; T899I), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Splicing factor 3B subunit 3 (SF3B3; T899I) . Accession Number: Q15393; SF3B3. Expression Region: 819-1217aa (T899I) . Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 52.1kda. Target Synonyms: Pre-mRNA-splicing factor SF3b 130 kDa subunit; SF3b130; STAF130; Spliceosome-associated protein 130; SAP 130 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Splicing factor 3B subunit 3 (SF3B3; T899I), partial is a purified Recombinant Protein.

Accession Number

Q15393; SF3B3

Expression Region

819-1217aa (T899I)

Host

E. coli

Target

Splicing factor 3B subunit 3 (SF3B3; T899I)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

52.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Pre-mRNA-splicing factor SF3b 130 kDa subunit; SF3b130; STAF130; Spliceosome-associated protein 130; SAP 130

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MAEEMVEAAGEDERELAAEMAAAFLNENLPESIFGAPKAGNGQWASVIRVMNPIQGNTLDLVQLEQNEAAFSVAVCRFSNIGEDWYVLVGVAKDLILNPRSVAGGFVYTYKLVNNGEKLEFLHKTPVEEVPAAIAPFQGRVLIGVGKLLRVYDLGKKKLLRKCENKHIANYISGIQTIGHRVIVSDVQESFIWVRYKRNENQLIIFADDTYPRWVTTASLLDYDTVAGADKFGNICVVRLPPNTNDEVDEDPTGNKALWDRGLLNGASQKAEVIMNYHVGETVLSLQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDFFQHVEMHLRSEHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPNKQKNVSEELDRTPPEVSKKLEDIRTRYAF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Prostatic Acid Phosphatase/ACPP Antibody (ACPP/1339) [Alexa Fluor 405]
NBP2-54417AF405 100 µL

Mouse Monoclonal Prostatic Acid Phosphatase/ACPP Antibody (ACPP/1339) [Alexa Fluor 405]

Sign In for Pricing
View Details
Rabbit anti-human death effector domain containing polyclonal Antibody
MBS714291-01 0.1 mL

Rabbit anti-human death effector domain containing polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human death effector domain containing polyclonal Antibody
MBS714291-02 5x 0.1 mL

Rabbit anti-human death effector domain containing polyclonal Antibody

Sign In for Pricing
View Details
Human Lipocalin 1 (LCN1) ELISA Kit
RD-LCN1-Hu-01 96 Tests

Human Lipocalin 1 (LCN1) ELISA Kit

Sign In for Pricing
View Details
Human Lipocalin 1 (LCN1) ELISA Kit
RD-LCN1-Hu-02 48 Tests

Human Lipocalin 1 (LCN1) ELISA Kit

Sign In for Pricing
View Details
Setdb1 (NM_001163642) Mouse Tagged ORF Clone
MR222934 10 µg

Setdb1 (NM_001163642) Mouse Tagged ORF Clone

Sign In for Pricing
View Details