Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus pumilus 2,3-diketo-5-methylthiopentyl-1-phosphate enolase (mtnW)

Recombinant Bacillus pumilus 2,3-diketo-5-methylthiopentyl-1-phosphate enolase (mtnW) is a purified Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bacillus pumilus (strain SAFR-032) . Target Name: 2,3-diketo-5-methylthiopentyl-1-phosphate enolase (mtnW) . Accession Number: A8FCG8; mtnW. Expression Region: 1-406aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 51.9kda. Target Synonyms: DK-MTP-1-P enolase; RuBisCO-like protein; RLP Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Bacillus pumilus 2,3-diketo-5-methylthiopentyl-1-phosphate enolase (mtnW) is a purified Recombinant Protein.

Accession Number

A8FCG8; mtnW

Expression Region

1-406aa

Host

E. coli

Target

2,3-diketo-5-methylthiopentyl-1-phosphate enolase (mtnW)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>95% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

51.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

DK-MTP-1-P enolase; RuBisCO-like protein; RLP

Species

Bacillus pumilus (strain SAFR-032)

Protein Name

Recombinant Protein

AA Sequence

MSELLATYVLTHREDEQVNRKAEQIALGLTVGSWTDLPQLKKEQLQKHKGRVEKVTEKFAPAENGLYQSEVTIAYPEANFSADIPAVLSTIFGKLSLDGKVKLVDIQFSDRFKKSLPGPVFGIDGIRKKTGVFDRPLLMSIFKGVIGRDMTDLKEQLRLQALGGVDFIKDDEILFESPLAPFEDRIKEGKKILKETYEETGHRTLYAVHLTGRTFELRDRARKAAELGADALLFNVFAYGLDVMQSLAEDPDIRLPIMAHPAVSGALTSSPEYGFSHSLLLGKLNRYAGADLSLFPSPYGSVALPKKDAFGIYEACVKEDSVQKTFPVPSAGIHPGMVPVLMKDFGLDHVINAGGGIHGHPRGAIGGGKAFRSIIDAVIHGESIQEKTASCQDLKAALELWGRVVE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calcium Voltage-Gated Channel Auxiliary Subunit Alpha2delta 2 (CACNA2D2) Antibody
abx134386-01 30 µL

Calcium Voltage-Gated Channel Auxiliary Subunit Alpha2delta 2 (CACNA2D2) Antibody

Sign In for Pricing
View Details
Calcium Voltage-Gated Channel Auxiliary Subunit Alpha2delta 2 (CACNA2D2) Antibody
abx134386-02 100 µL

Calcium Voltage-Gated Channel Auxiliary Subunit Alpha2delta 2 (CACNA2D2) Antibody

Sign In for Pricing
View Details
Calcium Voltage-Gated Channel Auxiliary Subunit Alpha2delta 2 (CACNA2D2) Antibody
abx134386-03 200 µL

Calcium Voltage-Gated Channel Auxiliary Subunit Alpha2delta 2 (CACNA2D2) Antibody

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Killer Cell Immunoglobulin Like Receptor 3DL2 (KIR3DL2)
MBS2050320-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Killer Cell Immunoglobulin Like Receptor 3DL2 (KIR3DL2)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Killer Cell Immunoglobulin Like Receptor 3DL2 (KIR3DL2)
MBS2050320-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to Killer Cell Immunoglobulin Like Receptor 3DL2 (KIR3DL2)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Killer Cell Immunoglobulin Like Receptor 3DL2 (KIR3DL2)
MBS2050320-03 0.5 mL

APC/CY7-Linked Polyclonal Antibody to Killer Cell Immunoglobulin Like Receptor 3DL2 (KIR3DL2)

Sign In for Pricing
View Details