Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant E. coli O157:H7 Cell division protein FtsZ (ftsZ)

Recombinant E. coli O157:H7 Cell division protein FtsZ (ftsZ) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli O157:H7. Target Name: Cell division protein FtsZ (ftsZ) . Accession Number: P0A9A8; ftsZ. Expression Region: 1-383aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 47.8kda. Target Synonyms: Cell division protein FtsZ Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant E. coli O157:H7 Cell division protein FtsZ (ftsZ) is a purified Recombinant Protein.

Accession Number

P0A9A8; ftsZ

Expression Region

1-383aa

Host

E. coli

Target

Cell division protein FtsZ (ftsZ)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

47.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Cell division protein FtsZ

Species

E. coli O157:H7

Protein Name

Recombinant Protein

AA Sequence

MFEPMELTNDAVIKVIGVGGGGGNAVEHMVRERIEGVEFFAVNTDAQALRKTAVGQTIQIGSGITKGLGAGANPEVGRNAADEDRDALRAALEGADMVFIAAGMGGGTGTGAAPVVAEVAKDLGILTVAVVTKPFNFEGKKRMAFAEQGITELSKHVDSLITIPNDKLLKVLGRGISLLDAFGAANDVLKGAVQGIAELITRPGLMNVDFADVRTVMSEMGYAMMGSGVASGEDRAEEAAEMAISSPLLEDIDLSGARGVLVNITAGFDLRLDEFETVGNTIRAFASDNATVVIGTSLDPDMNDELRVTVVATGIGMDKRPEITLVTNKQVQQPVMDRYQQHGMAPLTQEQKPVAKVVNDNAPQTAKEPDYLDIPAFLRKQAD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rag2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
38450116 3x 1.0 µg

Rag2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
PE anti-mouse CD321
GT05962 25 µg

PE anti-mouse CD321

Sign In for Pricing
View Details
Human Triglyceride, TG ELISA Kit
ELA-E1687h 96 Tests

Human Triglyceride, TG ELISA Kit

Sign In for Pricing
View Details
Wdfy1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4557008 1.0 µg DNA

Wdfy1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Canine Adeno Virus buffer
EIAR Canine Adeno Virus buffer 500 mL

Canine Adeno Virus buffer

Sign In for Pricing
View Details
SRP9 siRNA Oligos set (Human)
45488171 3x 5 nmol

SRP9 siRNA Oligos set (Human)

Sign In for Pricing
View Details