Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant E. coli O157:H7 Cell division protein FtsZ (ftsZ)

Recombinant E. coli O157:H7 Cell division protein FtsZ (ftsZ) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli O157:H7. Target Name: Cell division protein FtsZ (ftsZ) . Accession Number: P0A9A8; ftsZ. Expression Region: 1-383aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 47.8kda. Target Synonyms: Cell division protein FtsZ Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant E. coli O157:H7 Cell division protein FtsZ (ftsZ) is a purified Recombinant Protein.

Accession Number

P0A9A8; ftsZ

Expression Region

1-383aa

Host

E. coli

Target

Cell division protein FtsZ (ftsZ)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

47.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Cell division protein FtsZ

Species

E. coli O157:H7

Protein Name

Recombinant Protein

AA Sequence

MFEPMELTNDAVIKVIGVGGGGGNAVEHMVRERIEGVEFFAVNTDAQALRKTAVGQTIQIGSGITKGLGAGANPEVGRNAADEDRDALRAALEGADMVFIAAGMGGGTGTGAAPVVAEVAKDLGILTVAVVTKPFNFEGKKRMAFAEQGITELSKHVDSLITIPNDKLLKVLGRGISLLDAFGAANDVLKGAVQGIAELITRPGLMNVDFADVRTVMSEMGYAMMGSGVASGEDRAEEAAEMAISSPLLEDIDLSGARGVLVNITAGFDLRLDEFETVGNTIRAFASDNATVVIGTSLDPDMNDELRVTVVATGIGMDKRPEITLVTNKQVQQPVMDRYQQHGMAPLTQEQKPVAKVVNDNAPQTAKEPDYLDIPAFLRKQAD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal PD-L2/B7-DC/PDCD1LG2 Antibody (988708) [Janelia Fluor 669]
FAB12241JF669 0.1 mL

Mouse Monoclonal PD-L2/B7-DC/PDCD1LG2 Antibody (988708) [Janelia Fluor 669]

Sign In for Pricing
View Details
Human EPHA8 activation kit by CRISPRa
GA101425 1 Kit

Human EPHA8 activation kit by CRISPRa

Sign In for Pricing
View Details
Pelabresib (CPI 0610) 5mg
A16076-5 5 mg

Pelabresib (CPI 0610) 5mg

Sign In for Pricing
View Details
FAK (Focal Adhesion Kinase 1, FADK 1, pp125FAK, Protein-tyrosine Kinase 2, PTK2, FAK1)
F0019-54V 50 µg

FAK (Focal Adhesion Kinase 1, FADK 1, pp125FAK, Protein-tyrosine Kinase 2, PTK2, FAK1)

Sign In for Pricing
View Details
Caprisil C18 HPLC Column, 5 µm, 300 Å, CC558-C18 x 150 mm
CC258-C18 5 µm

Caprisil C18 HPLC Column, 5 µm, 300 Å, CC558-C18 x 150 mm

Sign In for Pricing
View Details
AK3L1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0064807 1.0 µg DNA

AK3L1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details