Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant E. coli O157:H7 Cell division protein FtsZ (ftsZ)

Recombinant E. coli O157:H7 Cell division protein FtsZ (ftsZ) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli O157:H7. Target Name: Cell division protein FtsZ (ftsZ) . Accession Number: P0A9A8; ftsZ. Expression Region: 1-383aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 47.8kda. Target Synonyms: Cell division protein FtsZ Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant E. coli O157:H7 Cell division protein FtsZ (ftsZ) is a purified Recombinant Protein.

Accession Number

P0A9A8; ftsZ

Expression Region

1-383aa

Host

E. coli

Target

Cell division protein FtsZ (ftsZ)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

47.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Cell division protein FtsZ

Species

E. coli O157:H7

Protein Name

Recombinant Protein

AA Sequence

MFEPMELTNDAVIKVIGVGGGGGNAVEHMVRERIEGVEFFAVNTDAQALRKTAVGQTIQIGSGITKGLGAGANPEVGRNAADEDRDALRAALEGADMVFIAAGMGGGTGTGAAPVVAEVAKDLGILTVAVVTKPFNFEGKKRMAFAEQGITELSKHVDSLITIPNDKLLKVLGRGISLLDAFGAANDVLKGAVQGIAELITRPGLMNVDFADVRTVMSEMGYAMMGSGVASGEDRAEEAAEMAISSPLLEDIDLSGARGVLVNITAGFDLRLDEFETVGNTIRAFASDNATVVIGTSLDPDMNDELRVTVVATGIGMDKRPEITLVTNKQVQQPVMDRYQQHGMAPLTQEQKPVAKVVNDNAPQTAKEPDYLDIPAFLRKQAD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GALT Antibody, Biotin conjugated
A22768-100UG 100 µg

GALT Antibody, Biotin conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal Nox4 Antibody [DyLight 550]
NBP2-99109R 0.1 mL

Rabbit Polyclonal Nox4 Antibody [DyLight 550]

Sign In for Pricing
View Details
Rabbit Total Procollagen Type I Intact N-Terminal Propeptide (TP1NP) ELISA Kit
MBS9355811 Inquire

Rabbit Total Procollagen Type I Intact N-Terminal Propeptide (TP1NP) ELISA Kit

Sign In for Pricing
View Details
TUBA8 Mouse Monoclonal Antibody [Clone ID: OTI2E9]
TA501038S 30 µL

TUBA8 Mouse Monoclonal Antibody [Clone ID: OTI2E9]

Sign In for Pricing
View Details
Accessories, Stainless Steel Centrifugal Stirrer - ABDOS
E11316 1 Unit/Pack

Accessories, Stainless Steel Centrifugal Stirrer - ABDOS

Sign In for Pricing
View Details
Moxd1 Mouse qPCR Template Standard (NM_021509)
MK202673 1 Kit

Moxd1 Mouse qPCR Template Standard (NM_021509)

Sign In for Pricing
View Details