Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vibrio parahaemolyticus serotype O3:K6 Thermostable direct hemolysin 1 (tdh1)

Recombinant Vibrio parahaemolyticus serotype O3:K6 Thermostable direct hemolysin 1 (tdh1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) . Target Name: Thermostable direct hemolysin 1 (tdh1) . Accession Number: P19249; tdh1. Expression Region: 25-189aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 26.0kda. Target Synonyms: Kanagawa phenomenon-associated hemolysin Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Vibrio parahaemolyticus serotype O3:K6 Thermostable direct hemolysin 1 (tdh1) is a purified Recombinant Protein.

Accession Number

P19249; tdh1

Expression Region

25-189aa

Host

E. coli

Target

Thermostable direct hemolysin 1 (tdh1)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

26.0kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Kanagawa phenomenon-associated hemolysin

Species

Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)

Protein Name

Recombinant Protein

AA Sequence

FELPSVPFPAPGSDEILFVVRDTTFNTQAPVNVKVSDFWTNRNVKRKPYEDVYGQSVFTTSGTKWLTSYMTVNINDKDYTMAAVSGYKSGHSAVFVKSGQVQLQHSYNSVANFVGEDEGSIPSKMYLDETPEYFVNVEAYESGSGNILVMCISNKESFFECKHQQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTH (Adrenocorticotrophic Hormone) (AH26), CF640R conjugate, 0.1mg/mL
BNC400026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF405S conjugate, 0.1mg/mL
BNC040175-500 1x 500 µL

CD46 (122.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF488A conjugate, 0.1mg/mL
BNC880040-500 1x 500 µL

CD35 / CR1 (E11), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF647 conjugate, 0.1mg/mL
BNC472853-500 1x 500 µL

CD54 / ICAM-1 (15.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10 + VWF635), CF640R conjugate, 0.1mg/mL
BNC400646-500 1x 500 µL

Von Willebrand Factor (3E2D10 + VWF635), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MHC II (HLA-DQ) (SPV-L3), CF405S conjugate, 0.1mg/mL
BNC040200-500 1x 500 µL

MHC II (HLA-DQ) (SPV-L3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details