Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human cytomegalovirus Envelope glycoprotein UL132 (UL132), partial, Biotinylated

Recombinant Human cytomegalovirus Envelope glycoprotein UL132 (UL132), partial, Biotinylated is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human cytomegalovirus (strain Towne) (HHV-5) (Human herpesvirus 5) . Target Name: cytomegalovirus Envelope glycoprotein UL132 (UL132), Biotinylated. Accession Number: P69339; UL132. Expression Region: 157-270aa. Tag Info: N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged. Theoretical MW: 61.1kda. Target Synonyms: L3 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human cytomegalovirus Envelope glycoprotein UL132 (UL132), partial, Biotinylated is a purified Recombinant Protein.

Accession Number

P69339; UL132

Expression Region

157-270aa

Host

E. coli

Target

Cytomegalovirus Envelope glycoprotein UL132 (UL132), Biotinylated

Conjugation

Unconjugated

Tag

N-Terminal MBP-Tagged and C-Terminal 6xHis-Avi-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

61.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

L3

Species

Human cytomegalovirus (strain Towne) (HHV-5) (Human herpesvirus 5)

Protein Name

Recombinant Protein

AA Sequence

SPYQRLETRDWDEEEEASAARERMKHDPENVIYFRKDGNLDTSFVNPNYGRGSPLTIESHLSDNEEDPIRYYVSVYDELTASEMEEPSNSTSWQIPKLMKVAMQPVSLRDPEYD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD112 (Poliovirus Receptor Related 2, PRR2) (PE)
C2447-35-PE 100 µL

CD112 (Poliovirus Receptor Related 2, PRR2) (PE)

Sign In for Pricing
View Details
Human BAFFR (B Cell Activating Factor Receptor) ELISA Kit
MBS2502344-01 24 Tests (Limit 1)

Human BAFFR (B Cell Activating Factor Receptor) ELISA Kit

Sign In for Pricing
View Details
Human BAFFR (B Cell Activating Factor Receptor) ELISA Kit
MBS2502344-02 48 Tests

Human BAFFR (B Cell Activating Factor Receptor) ELISA Kit

Sign In for Pricing
View Details
Human BAFFR (B Cell Activating Factor Receptor) ELISA Kit
MBS2502344-03 96 Tests

Human BAFFR (B Cell Activating Factor Receptor) ELISA Kit

Sign In for Pricing
View Details
Human BAFFR (B Cell Activating Factor Receptor) ELISA Kit
MBS2502344-04 5x 96 Tests

Human BAFFR (B Cell Activating Factor Receptor) ELISA Kit

Sign In for Pricing
View Details
Human BAFFR (B Cell Activating Factor Receptor) ELISA Kit
MBS2502344-05 10x 96 Tests

Human BAFFR (B Cell Activating Factor Receptor) ELISA Kit

Sign In for Pricing
View Details