Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Signal transducer and activator of transcription 3 (STAT3), partial

Recombinant Human Signal transducer and activator of transcription 3 (STAT3), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Signal transducer and activator of transcription 3 (STAT3) . Accession Number: P40763; STAT3. Expression Region: 50-240aa. Tag Info: N-terminal 6xHis-SUMO-tagged. Theoretical MW: 38.3kda. Target Synonyms: Acute-phase response factor Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Signal transducer and activator of transcription 3 (STAT3), partial is a purified Recombinant Protein.

Accession Number

P40763; STAT3

Expression Region

50-240aa

Host

E. coli

Target

Signal transducer and activator of transcription 3 (STAT3)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-SUMO-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

38.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Acute-phase response factor

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

ESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEEL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Oral-facial-digital syndrome 1 protein (OFD1) Mouse ELISA Kit
F5872 96 Tests

Oral-facial-digital syndrome 1 protein (OFD1) Mouse ELISA Kit

Sign In for Pricing
View Details
SUMO3 Protein Vector (Human) (pPB-N-His)
PV040862 500 ng

SUMO3 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
HIF1 alpha Antibody: ATTO 390
MBS803487-01 0.1 mg

HIF1 alpha Antibody: ATTO 390

Sign In for Pricing
View Details
HIF1 alpha Antibody: ATTO 390
MBS803487-02 5x 0.1 mg

HIF1 alpha Antibody: ATTO 390

Sign In for Pricing
View Details
Recombinant Epstein-Barr cytomegalovirus (HCMV) gB Protein, His-SUMO, E.coli-1mg
QP7275-ec-1mg 1mg

Recombinant Epstein-Barr cytomegalovirus (HCMV) gB Protein, His-SUMO, E.coli-1mg

Sign In for Pricing
View Details
Rno-miR-132-5p miRNA Agomir
CMS0426-01 5 nmol

Rno-miR-132-5p miRNA Agomir

Sign In for Pricing
View Details