Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Haptoglobin (Hp)

Recombinant Mouse Haptoglobin (Hp) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Haptoglobin (Hp) . Accession Number: Q61646; Hp. Expression Region: 19-347aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 40.9kda Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Haptoglobin (Hp) is a purified Recombinant Protein.

Accession Number

Q61646; Hp

Expression Region

19-347aa

Host

E. coli

Target

Haptoglobin (Hp)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged

Field of Research

Cardiovascular

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

40.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

VELGNDAMDFEDDSCPKPPEIANGYVEHLVRYRCRQFYRLRAEGDGVYTLNDEKQWVNTVAGEKLPECEAVCGKPKHPVDQVQRIIGGSMDAKGSFPWQAKMISRHGLTTGATLISDQWLLTTAKNLFLNHSETASAKDITPTLTLYVGKNQLVEIEKVVLHPNHSVVDIGLIKLKQRVLVTERVMPICLPSKDYIAPGRVGYVSGWGRNANFRFTDRLKYVMLPVADQDKCVVHYENSTVPEKKNLTSPVGVQPILNEHTFCAGLTKYQEDTCYGDAGSAFAIHDMEEDTWYAAGILSFDKSCAVAEYGVYVRATDLKDWVQETMAKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

smooth muscle Myosin heavy chain 11 (MYH11) (smooth) Mouse Monoclonal Antibody [Clone ID: MS-13]
AM20644PU-N 100 µg

smooth muscle Myosin heavy chain 11 (MYH11) (smooth) Mouse Monoclonal Antibody [Clone ID: MS-13]

Sign In for Pricing
View Details
Recombinant Paracoccus denitrificans PKHD-type hydroxylase Pden_4677 (Pden_4677)
MBS1130669-01 0.02 mg (E-Coli)

Recombinant Paracoccus denitrificans PKHD-type hydroxylase Pden_4677 (Pden_4677)

Sign In for Pricing
View Details
Recombinant Paracoccus denitrificans PKHD-type hydroxylase Pden_4677 (Pden_4677)
MBS1130669-02 0.1 mg (E-Coli)

Recombinant Paracoccus denitrificans PKHD-type hydroxylase Pden_4677 (Pden_4677)

Sign In for Pricing
View Details
Recombinant Paracoccus denitrificans PKHD-type hydroxylase Pden_4677 (Pden_4677)
MBS1130669-03 0.02 mg (Yeast)

Recombinant Paracoccus denitrificans PKHD-type hydroxylase Pden_4677 (Pden_4677)

Sign In for Pricing
View Details
Recombinant Paracoccus denitrificans PKHD-type hydroxylase Pden_4677 (Pden_4677)
MBS1130669-04 0.1 mg (Yeast)

Recombinant Paracoccus denitrificans PKHD-type hydroxylase Pden_4677 (Pden_4677)

Sign In for Pricing
View Details
Recombinant Paracoccus denitrificans PKHD-type hydroxylase Pden_4677 (Pden_4677)
MBS1130669-05 0.02 mg (Baculovirus)

Recombinant Paracoccus denitrificans PKHD-type hydroxylase Pden_4677 (Pden_4677)

Sign In for Pricing
View Details