Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Hyaluronan and proteoglycan link protein 1 (HAPLN1)

Recombinant Human Hyaluronan and proteoglycan link protein 1 (HAPLN1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Hyaluronan and proteoglycan link protein 1 (HAPLN1) . Accession Number: P10915; HAPLN1. Expression Region: 16-354aa. Tag Info: Tag-Free. Theoretical MW: 38.6kda. Target Synonyms: Cartilage-linking protein 1; Cartilage-link protein; Proteoglycan link protein Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Hyaluronan and proteoglycan link protein 1 (HAPLN1) is a purified Recombinant Protein.

Accession Number

P10915; HAPLN1

Expression Region

16-354aa

Host

E. coli

Target

Hyaluronan and proteoglycan link protein 1 (HAPLN1)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

38.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Cartilage-linking protein 1; Cartilage-link protein; Proteoglycan link protein

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

DHLSDNYTLDHDRAIHIQAENGPHLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIHKIRIKWTKLTSDYLKEVDVFVSMGYHKKTYGGYQGRVFLKGGSDSDASLVITDLTLEDYGRYKCEVIEGLEDDTVVVALDLQGVVFPYFPRLGRYNLNFHEAQQACLDQDAVIASFDQLYDAWRGGLDWCNAGWLSDGSVQYPITKPREPCGGQNTVPGVRNYGFWDKDKSRYDVFCFTSNFNGRFYYLIHPTKLTYDEAVQACLNDGAQIAKVGQIFAAWKILGYDRCDAGWLADGSVRYPISRPRRRCSPTEAAVRFVGFPDKKHKLYGVYCFRAYN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human RNF24 sgRNA gene knockout kit - Lentiviral human RNF24 sgRNA gene knockout kit (plasmid)
GTR15384161 1 Vial

Lentiviral human RNF24 sgRNA gene knockout kit - Lentiviral human RNF24 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Recombinant FeLV Infection accessory factor (aa 33-273) [His] Protein
VAng-Wyb2971-100gEcoli 100 µg (E. coli)

Recombinant FeLV Infection accessory factor (aa 33-273) [His] Protein

Sign In for Pricing
View Details
Mesothelin (MSLN) (NM_001177355) Human Tagged ORF Clone Lentiviral Particle
RC230361L2V 200 µL

Mesothelin (MSLN) (NM_001177355) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
ARF6 (NM_001663) Human Tagged ORF Clone Lentiviral Particle
RC203600L1V 200 µL

ARF6 (NM_001663) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Glypican 4 (GPC4)
MBS2050361-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Glypican 4 (GPC4)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Glypican 4 (GPC4)
MBS2050361-02 0.2 mL

Cy3-Linked Polyclonal Antibody to Glypican 4 (GPC4)

Sign In for Pricing
View Details