Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Fibroblast growth factor 2 (FGF2)

Recombinant Chicken Fibroblast growth factor 2 (FGF2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Chicken (Gallus) . Target Name: Fibroblast growth factor 2 (FGF2) . Accession Number: P48800; FGF2. Expression Region: 13-158aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 23.8kda. Target Synonyms: FGF-2; Basic fibroblast growth factor; bFGF; Heparin-binding growth factor 2; HBGF-2 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Chicken Fibroblast growth factor 2 (FGF2) is a purified Recombinant Protein.

Accession Number

P48800; FGF2

Expression Region

13-158aa

Host

E. coli

Target

Fibroblast growth factor 2 (FGF2)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

23.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

FGF-2; Basic fibroblast growth factor; bFGF; Heparin-binding growth factor 2; HBGF-2

Species

Chicken (Gallus)

Protein Name

Recombinant Protein

AA Sequence

PALPDDGGGGAFPPGHFKDPKRLYCKNGGFFLRINPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVSANRFLAMKEDGRLLALKCATEECFFFERLESNNYNTYRSRKYSDWYVALKRTGQYKPGPKTGPGQKAILFLPMSAKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal Antibody to Mitochondrial Uncoupling Protein 2 (UCP2)
TRV-0059534-01 20 µL

Monoclonal Antibody to Mitochondrial Uncoupling Protein 2 (UCP2)

Sign In for Pricing
View Details
Monoclonal Antibody to Mitochondrial Uncoupling Protein 2 (UCP2)
TRV-0059534-02 100 µL

Monoclonal Antibody to Mitochondrial Uncoupling Protein 2 (UCP2)

Sign In for Pricing
View Details
Monoclonal Antibody to Mitochondrial Uncoupling Protein 2 (UCP2)
TRV-0059534-03 200 µL

Monoclonal Antibody to Mitochondrial Uncoupling Protein 2 (UCP2)

Sign In for Pricing
View Details
Monoclonal Antibody to Mitochondrial Uncoupling Protein 2 (UCP2)
TRV-0059534-04 1 mL

Monoclonal Antibody to Mitochondrial Uncoupling Protein 2 (UCP2)

Sign In for Pricing
View Details
Recombinant Cytokeratin 8 Antibody / KRT8 / CK18
V8648-20UG 20 µg

Recombinant Cytokeratin 8 Antibody / KRT8 / CK18

Sign In for Pricing
View Details
Recombinant Human IL-1 Receptor Accessory Protein/IL-1RAcP/IL-1R3 Protein (C-Fc-6His)
MBS2552783-01 0.01 mg

Recombinant Human IL-1 Receptor Accessory Protein/IL-1RAcP/IL-1R3 Protein (C-Fc-6His)

Sign In for Pricing
View Details