Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Complement factor D (Cfd)

Recombinant Rat Complement factor D (Cfd) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus) . Target Name: Complement factor D (Cfd) . Accession Number: P32038; Cfd. Expression Region: 26-263aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 30.8kda. Target Synonyms: Adipsin C3 convertase activator Endogenous vascular elastase Properdin factor D Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Rat Complement factor D (Cfd) is a purified Recombinant Protein.

Accession Number

P32038; Cfd

Expression Region

26-263aa

Host

E. coli

Target

Complement factor D (Cfd)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

30.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Adipsin C3 convertase activator Endogenous vascular elastase Properdin factor D

Species

Rat (Rattus norvegicus)

Protein Name

Recombinant Protein

AA Sequence

ILGGQEAMAHARPYMASVQVNGTHVCGGTLVDEQWVLSAAHCMDGVTKDEVVQVLLGAHSLSSPEPYKHLYDVQSVVLHPGSRPDSVEDDLMLFKLSHNASLGPHVRPLPLQREDREVKPGTLCDVAGWGVVTHAGRRPDVLQQLTVSIMDRNTCNLRTYHDGAITKNMMCAESNRRDTCRGDSGGPLVCGDAVEAVVTWGSRVCGNRRKPGVFTRVATYVPWIENVLSGNVSVNVTA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADD3, CT (ADD3, ADDL, Gamma-adducin, Adducin-like protein 70) (MaxLight 490)
MBS6271723-01 0.1 mL

ADD3, CT (ADD3, ADDL, Gamma-adducin, Adducin-like protein 70) (MaxLight 490)

Sign In for Pricing
View Details
ADD3, CT (ADD3, ADDL, Gamma-adducin, Adducin-like protein 70) (MaxLight 490)
MBS6271723-02 5x 0.1 mL

ADD3, CT (ADD3, ADDL, Gamma-adducin, Adducin-like protein 70) (MaxLight 490)

Sign In for Pricing
View Details
Lentiviral human HMOX1 sgRNA gene knockout kit - Lentiviral human HMOX1 sgRNA gene knockout kit (25)
GTR15385647 1 Vial

Lentiviral human HMOX1 sgRNA gene knockout kit - Lentiviral human HMOX1 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Regaloside H
M29431-01 1 g

Regaloside H

Sign In for Pricing
View Details
Regaloside H
M29431-02 100 mg

Regaloside H

Sign In for Pricing
View Details
Regaloside H
M29431-03 200 mg

Regaloside H

Sign In for Pricing
View Details