Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Somatostatin receptor type 2 (SSTR2)

Recombinant Human Somatostatin receptor type 2 (SSTR2) is a purified CF Transmembrane Protein. Purity: >85% as determined by SDS-PAGE. Host: in vitro E. coli expression system. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Somatostatin receptor type 2 (SSTR2) . Accession Number: P30874; SSTR2. Expression Region: 1-369aa. Tag Info: N-terminal 10xHis-tagged. Theoretical MW: 47.4kda. Target Synonyms: SS-2-R; SS2-R; SS2R; SST2; SRIF-1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Somatostatin receptor type 2 (SSTR2) is a purified CF Transmembrane Protein.

Accession Number

P30874; SSTR2

Expression Region

1-369aa

Host

E. coli

Target

Somatostatin receptor type 2 (SSTR2)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

47.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

SS-2-R; SS2-R; SS2R; SST2; SRIF-1

Species

Human (Homo sapiens)

Protein Name

CF Transmembrane Protein

AA Sequence

MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCGNTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMTVDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMITMAVWGVSLLVILPIMIYAGLRSNQWGRSSCTINWPGESGAWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSSGIRVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPALKGMFDFVVVLTYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTLLNGDLQTSI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Peptidoglycan (PG) ELISA Kit
EIA06204Bo 1 Kit

Bovine Peptidoglycan (PG) ELISA Kit

Sign In for Pricing
View Details
RORC Recombinant Protein
OPCD06740-200UG 200 µg

RORC Recombinant Protein

Sign In for Pricing
View Details
GOT2, Recombinant, Mouse, aa30-430, His-Tag
532309-01 50 µg

GOT2, Recombinant, Mouse, aa30-430, His-Tag

Sign In for Pricing
View Details
GOT2, Recombinant, Mouse, aa30-430, His-Tag
532309-02 100 µg

GOT2, Recombinant, Mouse, aa30-430, His-Tag

Sign In for Pricing
View Details
KANSL1 (KIAA1267) ORF Vector (Human) (pORF)
25598011 1.0 µg DNA

KANSL1 (KIAA1267) ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Mouse Monoclonal C4orf42 Antibody (OTI2C6) [Alexa Fluor 700]
NBP2-72333AF700 0.1 mL

Mouse Monoclonal C4orf42 Antibody (OTI2C6) [Alexa Fluor 700]

Sign In for Pricing
View Details