Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Somatostatin receptor type 2 (SSTR2)

Recombinant Human Somatostatin receptor type 2 (SSTR2) is a purified CF Transmembrane Protein. Purity: >85% as determined by SDS-PAGE. Host: in vitro E. coli expression system. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Somatostatin receptor type 2 (SSTR2) . Accession Number: P30874; SSTR2. Expression Region: 1-369aa. Tag Info: N-terminal 10xHis-tagged. Theoretical MW: 47.4kda. Target Synonyms: SS-2-R; SS2-R; SS2R; SST2; SRIF-1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Somatostatin receptor type 2 (SSTR2) is a purified CF Transmembrane Protein.

Accession Number

P30874; SSTR2

Expression Region

1-369aa

Host

E. coli

Target

Somatostatin receptor type 2 (SSTR2)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

47.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

SS-2-R; SS2-R; SS2R; SST2; SRIF-1

Species

Human (Homo sapiens)

Protein Name

CF Transmembrane Protein

AA Sequence

MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCGNTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMTVDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMITMAVWGVSLLVILPIMIYAGLRSNQWGRSSCTINWPGESGAWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSSGIRVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPALKGMFDFVVVLTYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTLLNGDLQTSI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human α Lactalbumin (α-La) Elisa Kit
EK711544 96 Well

Human α Lactalbumin (α-La) Elisa Kit

Sign In for Pricing
View Details
Histone H2A.X Rabbit Polyclonal Antibody
APRab12058-01 20 µL

Histone H2A.X Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Histone H2A.X Rabbit Polyclonal Antibody
APRab12058-02 50 µL

Histone H2A.X Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Histone H2A.X Rabbit Polyclonal Antibody
APRab12058-03 100 µL

Histone H2A.X Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Histone H2A.X Rabbit Polyclonal Antibody
APRab12058-04 200 µL

Histone H2A.X Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Gramd1c (NM_001172107) Mouse Tagged Lenti ORF Clone
MR216904L4 10 µg

Gramd1c (NM_001172107) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details