Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant E. coli Modification methylase EcoRV (ecoRVM)

Recombinant E. coli Modification methylase EcoRV (ecoRVM) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli. Target Name: Modification methylase EcoRV (ecoRVM) . Accession Number: P04393; ecoRVM. Expression Region: 1-298aa. Tag Info: N-terminal 6xHis-SUMO-tagged. Theoretical MW: 50.6kda. Target Synonyms: Adenine-specific methyltransferase EcoRV Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant E. coli Modification methylase EcoRV (ecoRVM) is a purified Recombinant Protein.

Accession Number

P04393; ecoRVM

Expression Region

1-298aa

Host

E. coli

Target

Modification methylase EcoRV (ecoRVM)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-SUMO-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

50.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Adenine-specific methyltransferase EcoRV

Species

E. coli

Protein Name

Recombinant Protein

AA Sequence

MKDKVFVPPIKSQGIKTKLVPCIKRIVPKNFNGVWVEPFMGTGVVAFNVAPKDALLCDTNPHLISFYNALKNKDITGDLVKDFLYREGEKLLLSNGEYYYEVRERFNNYKEPLDFLFLNRSCFNGMIRFNSKGGFNVPFCKKPNRFAQAYITKISNQVDRISEIISKGNYTFLCQSFEKTIGMVNRDDVVYCDPPYIGRHVDYFNSWGERDERLLFETLSSLNATFITSTWHHNDYRENKYVRDLWSSFRILTKEHFYHVGASEKNRSPMVEALITNIAKDIIDHIEKSSGDILVIEE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAOA Antibody (C-term)
E45M06334G-1 100 µL

MAOA Antibody (C-term)

Sign In for Pricing
View Details
Recombinant Streptococcus Pneumoniae glmM Protein (aa 1-450) (strain CGSP14)
VAng-Ly1122-50gEcoli 50 µg (E. coli)

Recombinant Streptococcus Pneumoniae glmM Protein (aa 1-450) (strain CGSP14)

Sign In for Pricing
View Details
Rabbit LIM and SH3 domain protein 1,LASP1 ELISA KIT
ELI-23332Ra 96 Tests

Rabbit LIM and SH3 domain protein 1,LASP1 ELISA KIT

Sign In for Pricing
View Details
LMCD1 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
26901064 1.0 µg DNA

LMCD1 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Recombinant Trichophyton rubrum Subtilisin-like protease 6 (SUB6)
MBS1315978-01 0.02 mg (E-Coli)

Recombinant Trichophyton rubrum Subtilisin-like protease 6 (SUB6)

Sign In for Pricing
View Details
Recombinant Trichophyton rubrum Subtilisin-like protease 6 (SUB6)
MBS1315978-02 0.02 mg (Yeast)

Recombinant Trichophyton rubrum Subtilisin-like protease 6 (SUB6)

Sign In for Pricing
View Details