Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhizobium meliloti Nodulation protein H (nodH)

Recombinant Rhizobium meliloti Nodulation protein H (nodH) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rhizobium meliloti (Ensifer meliloti) (Sinorhizobium meliloti) . Target Name: Nodulation protein H (nodH) . Accession Number: P06237; nodH. Expression Region: 1-247aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 36.1kda. Target Synonyms: Host-specificity of nodulation protein D Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Rhizobium meliloti Nodulation protein H (nodH) is a purified Recombinant Protein.

Accession Number

P06237; nodH

Expression Region

1-247aa

Host

E. coli

Target

Nodulation protein H (nodH)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

36.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Host-specificity of nodulation protein D

Species

Rhizobium meliloti (Ensifer meliloti) (Sinorhizobium meliloti)

Protein Name

Recombinant Protein

AA Sequence

MTHSTLPPRPFAILAMRRTGTHYLEELVNEHPNVLSNGELLNTYDTNWPDKERLLLSDRELLERACWRYPPHSDKKVTHVGCKINEPQFQERPSFFAELTAWPGLKVILVIRRNTLESLRSFVQARQTRQWLQFKSDSSAPPPPVMLPFATCEAYFKAADDFHARVVNAFDSSRIRLIEYERLLRDPVPCVATVLDFLGAPALQLADRGILRRQETRPLDQTVRNFHELRVHFANGPYARFFELAND

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SpUlp1 (S. pombe Ubiquitin-like Protein 1, SpUlp 1, SpUlp-1) (MaxLight 490)
MBS6453616-01 0.1 mL

SpUlp1 (S. pombe Ubiquitin-like Protein 1, SpUlp 1, SpUlp-1) (MaxLight 490)

Sign In for Pricing
View Details
SpUlp1 (S. pombe Ubiquitin-like Protein 1, SpUlp 1, SpUlp-1) (MaxLight 490)
MBS6453616-02 5x 0.1 mL

SpUlp1 (S. pombe Ubiquitin-like Protein 1, SpUlp 1, SpUlp-1) (MaxLight 490)

Sign In for Pricing
View Details
PDXDC1 Antibody, HRP conjugated
A59038-50UG 50 µg

PDXDC1 Antibody, HRP conjugated

Sign In for Pricing
View Details
Cynomolgus IL-23 R Protein, Fc Tag
ILR-C5251-1mg 1 mg

Cynomolgus IL-23 R Protein, Fc Tag

Sign In for Pricing
View Details
Human Pregnancy Specific beta1 Glycoprotein ELISA Kit
MBS030147-01 48 Well

Human Pregnancy Specific beta1 Glycoprotein ELISA Kit

Sign In for Pricing
View Details
Human Pregnancy Specific beta1 Glycoprotein ELISA Kit
MBS030147-02 96 Well

Human Pregnancy Specific beta1 Glycoprotein ELISA Kit

Sign In for Pricing
View Details