Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhizobium meliloti Nodulation protein H (nodH)

Recombinant Rhizobium meliloti Nodulation protein H (nodH) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rhizobium meliloti (Ensifer meliloti) (Sinorhizobium meliloti) . Target Name: Nodulation protein H (nodH) . Accession Number: P06237; nodH. Expression Region: 1-247aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 36.1kda. Target Synonyms: Host-specificity of nodulation protein D Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Rhizobium meliloti Nodulation protein H (nodH) is a purified Recombinant Protein.

Accession Number

P06237; nodH

Expression Region

1-247aa

Host

E. coli

Target

Nodulation protein H (nodH)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

36.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Host-specificity of nodulation protein D

Species

Rhizobium meliloti (Ensifer meliloti) (Sinorhizobium meliloti)

Protein Name

Recombinant Protein

AA Sequence

MTHSTLPPRPFAILAMRRTGTHYLEELVNEHPNVLSNGELLNTYDTNWPDKERLLLSDRELLERACWRYPPHSDKKVTHVGCKINEPQFQERPSFFAELTAWPGLKVILVIRRNTLESLRSFVQARQTRQWLQFKSDSSAPPPPVMLPFATCEAYFKAADDFHARVVNAFDSSRIRLIEYERLLRDPVPCVATVLDFLGAPALQLADRGILRRQETRPLDQTVRNFHELRVHFANGPYARFFELAND

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

17-DMAG HCl 50mg
A10011-50 50 mg

17-DMAG HCl 50mg

Sign In for Pricing
View Details
Platelet Derived Growth Factor Receptor alpha (PDGFRa) (PE)
MBS6493923-01 0.1 mL

Platelet Derived Growth Factor Receptor alpha (PDGFRa) (PE)

Sign In for Pricing
View Details
Platelet Derived Growth Factor Receptor alpha (PDGFRa) (PE)
MBS6493923-02 5x 0.1 mL

Platelet Derived Growth Factor Receptor alpha (PDGFRa) (PE)

Sign In for Pricing
View Details
PLOD3 Rabbit Polyclonal Antibody
TA366694 100 µL

PLOD3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal IKK beta Antibody (10AG2) [DyLight 350]
NB100-56509UV 0.1 mL

Mouse Monoclonal IKK beta Antibody (10AG2) [DyLight 350]

Sign In for Pricing
View Details
Glucagon Receptor Polyclonal Antibody
UB-GEN-13069 100 µL

Glucagon Receptor Polyclonal Antibody

Sign In for Pricing
View Details