Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lactobacillus plantarum L-lactate dehydrogenase 1 (ldh1)

Recombinant Lactobacillus plantarum L-lactate dehydrogenase 1 (ldh1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) . Target Name: L-lactate dehydrogenase 1 (ldh1) . Accession Number: P56512; ldh1. Expression Region: 1-320aa. Tag Info: N-terminal GST-tagged. Theoretical MW: 61.2kda. Target Synonyms: ldh1; l-ldhL; ldh; ldhL; ldhL1; lp_0537L-lactate dehydrogenase 1; L-LDH 1; EC 1.1.1.27 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Lactobacillus plantarum L-lactate dehydrogenase 1 (ldh1) is a purified Recombinant Protein.

Accession Number

P56512; ldh1

Expression Region

1-320aa

Host

E. coli

Target

L-lactate dehydrogenase 1 (ldh1)

Conjugation

Unconjugated

Tag

N-Terminal GST-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

61.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Ldh1; l-ldhL; ldh; ldhL; ldhL1; lp_0537L-lactate dehydrogenase 1; L-LDH 1; EC 1.1.1.27

Species

Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)

Protein Name

Recombinant Protein

AA Sequence

MSSMPNHQKVVLVGDGAVGSSYAFAMAQQGIAEEFVIVDVVKDRTKGDALDLEDAQAFTAPKKIYSGEYSDCKDADLVVITAGAPQKPGESRLDLVNKNLNILSSIVKPVVDSGFDGIFLVAANPVDILTYATWKFSGFPKDRVIGSGTSLDSSRLRVALGKQFNVDPRSVDAYIMGEHGDSEFAAYSTATIGTRPVRDVAKEQGVSDEDLAKLEDGVRNKAYDIINLKGATFYGIGTALMRISKAILRDENAVLPVGAYMDGQYGLNDIYIGTPAVIGGTGLKQIIESPLSADELKKMQDSAATLKKVLNDGLAELENK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rinderine N-oxide
MF-0158619-01 5 mg

Rinderine N-oxide

Sign In for Pricing
View Details
Rinderine N-oxide
MF-0158619-02 50 mg

Rinderine N-oxide

Sign In for Pricing
View Details
Recombinant Theileria annulata Cell division control protein 2 homolog (CRK2)
MBS1376931-01 0.02 mg (E-Coli)

Recombinant Theileria annulata Cell division control protein 2 homolog (CRK2)

Sign In for Pricing
View Details
Recombinant Theileria annulata Cell division control protein 2 homolog (CRK2)
MBS1376931-02 0.02 mg (Yeast)

Recombinant Theileria annulata Cell division control protein 2 homolog (CRK2)

Sign In for Pricing
View Details
Recombinant Theileria annulata Cell division control protein 2 homolog (CRK2)
MBS1376931-03 0.1 mg (E-Coli)

Recombinant Theileria annulata Cell division control protein 2 homolog (CRK2)

Sign In for Pricing
View Details
Recombinant Theileria annulata Cell division control protein 2 homolog (CRK2)
MBS1376931-04 0.1 mg (Yeast)

Recombinant Theileria annulata Cell division control protein 2 homolog (CRK2)

Sign In for Pricing
View Details