Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vaccinia virus Pseudokinase OPG198 (B12)

Recombinant Vaccinia virus Pseudokinase OPG198 (B12) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Vaccinia virus (strain Copenhagen) (VACV) . Target Name: Pseudokinase OPG198 (B12) . Accession Number: P21098; B12. Expression Region: 1-283aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 40.8kda Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Vaccinia virus Pseudokinase OPG198 (B12) is a purified Recombinant Protein.

Accession Number

P21098; B12

Expression Region

1-283aa

Host

E. coli

Target

Pseudokinase OPG198 (B12)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

40.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Vaccinia virus (strain Copenhagen) (VACV)

Protein Name

Recombinant Protein

AA Sequence

MESFKYCFDNDGKKWIIGNTLYSGNSILYKVRKNFTSSFYNYVMKIDHKSHKPLLSEIRFYISVLDPLTIDNWTRERGIKYLAIPDLYGIGETDDYMFFVIKNLGRVFAPKDTESVFEACVTMINTLEFIHSRGFTHGKIEPRNILIRNKRLSLIDYSRTNKLYKSGNSHIDYNEDMITSGNINYMCVDNHLGATVSRRGDLEMLGYCMIEWFGGKLPWKNESSIKVIKQKKEYKKFIATFFEDCFPEGNEPLELVRYIELVYTLDYSQTPNYDRLRRLFIQD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsa-miR-4278 mimic
HY-R00957-01 5 nmol

Hsa-miR-4278 mimic

Sign In for Pricing
View Details
Hsa-miR-4278 mimic
HY-R00957-02 20 nmol

Hsa-miR-4278 mimic

Sign In for Pricing
View Details
Lentiviral human ITGA1 shRNA (UAS) - Lentiviral human ITGA1 shRNA (UAS, RFP) plasmid
GTR15286573 1 Vial

Lentiviral human ITGA1 shRNA (UAS) - Lentiviral human ITGA1 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Porcine MASP1 (Mannan Associated Serine Protease 1) ELISA Kit
MBS2510243-01 24 Tests

Porcine MASP1 (Mannan Associated Serine Protease 1) ELISA Kit

Sign In for Pricing
View Details
Porcine MASP1 (Mannan Associated Serine Protease 1) ELISA Kit
MBS2510243-02 48 Tests

Porcine MASP1 (Mannan Associated Serine Protease 1) ELISA Kit

Sign In for Pricing
View Details
Porcine MASP1 (Mannan Associated Serine Protease 1) ELISA Kit
MBS2510243-03 96 Tests

Porcine MASP1 (Mannan Associated Serine Protease 1) ELISA Kit

Sign In for Pricing
View Details