Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Reduced folate transporter (SLC19A1), partial

Recombinant Human Reduced folate transporter (SLC19A1), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Reduced folate transporter (SLC19A1) . Accession Number: P41440; SLC19A1. Expression Region: 420-591aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 25.5kda. Target Synonyms: FOLT; Cyclic dinucleotide:anion antiporter SLC19A1; Folate:anion antiporter SLC19A1; Intestinal folate carrier 1; IFC-1; Placental folate transporter; Reduced folate carrier protein; RFC; hRFC; Reduced folate transporter 1; RFT-1; Solute carrier family 19 member 1; hSLC19A1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Reduced folate transporter (SLC19A1), partial is a purified Recombinant Protein.

Accession Number

P41440; SLC19A1

Expression Region

420-591aa

Host

E. coli

Target

Reduced folate transporter (SLC19A1)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

25.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

FOLT; Cyclic dinucleotide:anion antiporter SLC19A1; Folate:anion antiporter SLC19A1; Intestinal folate carrier 1; IFC-1; Placental folate transporter; Reduced folate carrier protein; RFC; hRFC; Reduced folate transporter 1; RFT-1; Solute carrier family 19 member 1; hSLC19A1

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

DVRGLGLPVRKQFQLYSVYFLILSIIYFLGAMLDGLRHCQRGHHPRQPPAQGLRSAAEEKAAQALSVQDKGLGGLQPAQSPPLSPEDSLGAVGPASLEQRQSDPYLAQAPAPQAAEFLSPVTTPSPCTLCSAQASGPEAADETCPQLAVHPPGVSKLGLQCLPSDGVQNVNQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Immunoglobulin Heavy Constant Gamma 2 (IGHG2) ELISA Kit
MBS9920389 Inquire

Rabbit Immunoglobulin Heavy Constant Gamma 2 (IGHG2) ELISA Kit

Sign In for Pricing
View Details
Zebrafish VTG2 Rabbit Polyclonal Antibody (Carrier-free)
orb3090555 100 µg

Zebrafish VTG2 Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details
RILP Blocking Peptide
MBS9632961-01 1 mg

RILP Blocking Peptide

Sign In for Pricing
View Details
RILP Blocking Peptide
MBS9632961-02 5x 1 mg

RILP Blocking Peptide

Sign In for Pricing
View Details
LHFPL5 Human qPCR Template Standard (NM_182548)
HK204331 1 Kit

LHFPL5 Human qPCR Template Standard (NM_182548)

Sign In for Pricing
View Details
ATP6AP2 Rabbit pAb
E45R26608N-50 50 µL

ATP6AP2 Rabbit pAb

Sign In for Pricing
View Details