Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Mitogen-activated protein kinase 14 (Mapk14)

Recombinant Mouse Mitogen-activated protein kinase 14 (Mapk14) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Mitogen-activated protein kinase 14 (Mapk14) . Accession Number: P47811; Mapk14. Expression Region: 2-360aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 48.6kda. Target Synonyms: MAP kinase 14; MAPK 14; CRK1; Mitogen-activated protein kinase p38 alpha; MAP kinase p38 alpha Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Mitogen-activated protein kinase 14 (Mapk14) is a purified Recombinant Protein.

Accession Number

P47811; Mapk14

Expression Region

2-360aa

Host

E. coli

Target

Mitogen-activated protein kinase 14 (Mapk14)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

48.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

MAP kinase 14; MAPK 14; CRK1; Mitogen-activated protein kinase p38 alpha; MAP kinase p38 alpha

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

SQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCM5 (NM_006739) Human Tagged ORF Clone Lentiviral Particle
RC201668L2V 200 µL

MCM5 (NM_006739) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
VEGFR2 Polyclonal Antibody
E44H07287 100 µL

VEGFR2 Polyclonal Antibody

Sign In for Pricing
View Details
SMPDL3B Rabbit Polyclonal Antibody (Biotin)
orb452236 100 µL

SMPDL3B Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Rabbit Anti-Mouse CASR Polyclonal Antibody
PA84881MO-01 50 µg

Rabbit Anti-Mouse CASR Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Mouse CASR Polyclonal Antibody
PA84881MO-02 100 µg

Rabbit Anti-Mouse CASR Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Mouse CASR Polyclonal Antibody
PA84881MO-03 500 µg

Rabbit Anti-Mouse CASR Polyclonal Antibody

Sign In for Pricing
View Details