Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Atypical chemokine receptor 1 (ACKR1), Active Protein

Recombinant Human Atypical chemokine receptor 1 (ACKR1), Active Protein is a purified CF Transmembrane Protein; Active Protein. Purity: >85% as determined by SDS-PAGE. Host: in vitro E. coli expression system. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Atypical chemokine receptor 1 (ACKR1) . Accession Number: Q16570; ACKR1. Expression Region: 1-336aa. Tag Info: N-terminal 10xHis-tagged. Theoretical MW: 41.1kda. Target Synonyms: Duffy antigen/chemokine receptor Fy glycoprotein; GpFy Glycoprotein D Plasmodium vivax receptor CD_antigen: CD234 DARC; FY; GPD Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Atypical chemokine receptor 1 (ACKR1), Active Protein is a purified CF Transmembrane Protein; Active Protein.

Accession Number

Q16570; ACKR1

Expression Region

1-336aa

Host

E. coli

Target

Atypical chemokine receptor 1 (ACKR1)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged

Field of Research

Cardiovascular

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Biologically Active

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

41.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Duffy antigen/chemokine receptor Fy glycoprotein; GpFy Glycoprotein D Plasmodium vivax receptor CD_antigen: CD234 DARC; FY; GPD

Species

Human (Homo sapiens)

Protein Name

CF Transmembrane Protein; Active Protein

AA Sequence

MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDSALPFFILTSVLGILASSTVLFMLFRPLFRWQLCPGWPVLAQLAVGSALFSIVVPVLAPGLGSTRSSALCSLGYCVWYGSAFAQALLLGCHASLGHRLGAGQVPGLTLGLTVGIWGVAALLTLPVTLASGASGGLCTLIYSTELKALQATHTVACLAIFVLLPLGLFGAKGLKKALGMGPGPWMNILWAWFIFWWPHGVVLGLDFLVRSKLLLLSTCLAQQALDLLLNLAEALAILHCVATPLLLALFCHQATRTLLPSLPLPEGWSSHLDTLGSKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MART-1 / Melan-A (M2-7C10), CF594 conjugate, 0.1mg/mL
BNC940009-500 1x 500 µL

MART-1 / Melan-A (M2-7C10), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF740 conjugate, 0.1mg/mL
BNC740193-500 1x 500 µL

CD86 (BU63), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF740 conjugate, 0.1mg/mL
BNC740175-500 1x 500 µL

CD46 (122.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF647 conjugate, 0.1mg/mL
BNC470253-500 1x 500 µL

Cytokeratin, LMW (AE-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF647 conjugate, 0.1mg/mL
BNC470026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8 (KRT8) (KRT8/2115), CF647 conjugate, 0.1mg/mL
BNC472115-500 1x 500 µL

Cytokeratin 8 (KRT8) (KRT8/2115), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details