Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Burkholderia thailandensis Type III secretion system needle protein (yscF)

Recombinant Burkholderia thailandensis Type III secretion system needle protein (yscF) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CIP 106301 / E264) . Target Name: Type III secretion system needle protein (yscF) . Accession Number: Q2T727; yscF. Expression Region: 1-89aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 11.4kDa Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Burkholderia thailandensis Type III secretion system needle protein (yscF) is a purified Recombinant Protein.

Accession Number

Q2T727; yscF

Expression Region

1-89aa

Host

Yeast

Target

Type III secretion system needle protein (yscF)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

11.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CIP 106301 / E264)

Protein Name

Recombinant Protein

AA Sequence

MSNPPTPLLTDYEWSGYLTGIGRAFDTGVKDLNQQLQDAQANLTKNPSDPTALANYQMIMSEYNLYRNAQSSAVKSMKDIDSSIVSNFR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCN3A (NM_001081677) Human Tagged ORF Clone
RG212275 10 µg

SCN3A (NM_001081677) Human Tagged ORF Clone

Request Quote
View Details
DNAJC25, ID (DNAJC25, DnaJ homolog subfamily C member 25) (MaxLight 650)
MBS6292814-01 0.1 mL

DNAJC25, ID (DNAJC25, DnaJ homolog subfamily C member 25) (MaxLight 650)

Request Quote
View Details
DNAJC25, ID (DNAJC25, DnaJ homolog subfamily C member 25) (MaxLight 650)
MBS6292814-02 5x 0.1 mL

DNAJC25, ID (DNAJC25, DnaJ homolog subfamily C member 25) (MaxLight 650)

Request Quote
View Details
Lentiviral mouse Lck shRNA (UAS) - Lentiviral mouse Lck shRNA (UAS) (100)
GTR15264306 1 Vial

Lentiviral mouse Lck shRNA (UAS) - Lentiviral mouse Lck shRNA (UAS) (100)

Request Quote
View Details
ADP/ATP Translocase 2 (SLC25A5) Antibody
abx237945 100 µg

ADP/ATP Translocase 2 (SLC25A5) Antibody

Request Quote
View Details
Mouse Monoclonal RAIDD/CRADD Antibody (14G8)
NBP2-42688 100 µL

Mouse Monoclonal RAIDD/CRADD Antibody (14G8)

Request Quote
View Details