Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Metalloproteinase inhibitor 2 (TIMP2)

Recombinant Human Metalloproteinase inhibitor 2 (TIMP2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Metalloproteinase inhibitor 2 (TIMP2) . Accession Number: P16035; TIMP2. Expression Region: 27-220aa. Tag Info: C-terminal 6xHis-myc-tagged. Theoretical MW: 25.1kda. Target Synonyms: CSC-21KTissue inhibitor of metalloproteinases 2; TIMP-2 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Metalloproteinase inhibitor 2 (TIMP2) is a purified Recombinant Protein.

Accession Number

P16035; TIMP2

Expression Region

27-220aa

Host

Mammalian Cells

Target

Metalloproteinase inhibitor 2 (TIMP2)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-myc-Tagged

Field of Research

Cardiovascular

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

25.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

CSC-21KTissue inhibitor of metalloproteinases 2; TIMP-2

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Caveolae-Associated Protein 2 (CAVIN2) Antibody
abx377106-01 50 µg

Caveolae-Associated Protein 2 (CAVIN2) Antibody

Sign In for Pricing
View Details
Caveolae-Associated Protein 2 (CAVIN2) Antibody
abx377106-02 100 µg

Caveolae-Associated Protein 2 (CAVIN2) Antibody

Sign In for Pricing
View Details
Sn1-specific diacylglycerol lipase β (DAGLB) Human ELISA Kit
H1338 96 Tests

Sn1-specific diacylglycerol lipase β (DAGLB) Human ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Atrx shRNA (UAS) - Lentiviral mouse Atrx shRNA (UAS, iRFP) plasmid
GTR15211636 1 Vial

Lentiviral mouse Atrx shRNA (UAS) - Lentiviral mouse Atrx shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Ctsd Rabbit Polyclonal Antibody
TA356142 100 µL

Ctsd Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
AF 430 azide
MF-0062084-01 10 mg

AF 430 azide

Sign In for Pricing
View Details