Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Metalloproteinase inhibitor 2 (TIMP2)

Recombinant Human Metalloproteinase inhibitor 2 (TIMP2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Metalloproteinase inhibitor 2 (TIMP2) . Accession Number: P16035; TIMP2. Expression Region: 27-220aa. Tag Info: C-terminal 6xHis-myc-tagged. Theoretical MW: 25.1kda. Target Synonyms: CSC-21KTissue inhibitor of metalloproteinases 2; TIMP-2 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Metalloproteinase inhibitor 2 (TIMP2) is a purified Recombinant Protein.

Accession Number

P16035; TIMP2

Expression Region

27-220aa

Host

Mammalian Cells

Target

Metalloproteinase inhibitor 2 (TIMP2)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-myc-Tagged

Field of Research

Cardiovascular

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

25.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

CSC-21KTissue inhibitor of metalloproteinases 2; TIMP-2

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

His-Tag Rabbit Polyclonal Antibody
ES1144-01 50 µL

His-Tag Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
His-Tag Rabbit Polyclonal Antibody
ES1144-02 100 µL

His-Tag Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse Cables2 shRNA (UAS) - Lentiviral mouse Cables2 shRNA (UAS, iRFP) (100)
GTR15131451 1 Vial

Lentiviral mouse Cables2 shRNA (UAS) - Lentiviral mouse Cables2 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
NRXN1 (Neurexin 1, DKFZp313P2036, FLJ35941, Hs.22998, KIAA0578) (MaxLight 750) discontinued
249500-ML750 100 µL

NRXN1 (Neurexin 1, DKFZp313P2036, FLJ35941, Hs.22998, KIAA0578) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Recombinant Chloroflexus aurantiacus ATP synthase subunit beta (atpD)
MBS1113540-01 0.02 mg (E-Coli)

Recombinant Chloroflexus aurantiacus ATP synthase subunit beta (atpD)

Sign In for Pricing
View Details
Recombinant Chloroflexus aurantiacus ATP synthase subunit beta (atpD)
MBS1113540-02 0.02 mg (Yeast)

Recombinant Chloroflexus aurantiacus ATP synthase subunit beta (atpD)

Sign In for Pricing
View Details