Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human E3 ubiquitin-protein ligase TRIM9 (TRIM9)

Recombinant Human E3 ubiquitin-protein ligase TRIM9 (TRIM9) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: E3 ubiquitin-protein ligase TRIM9 (TRIM9) . Accession Number: Q9C026; TRIM9. Expression Region: 1-550aa. Tag Info: N-terminal 6xHis-SUMO-tagged. Theoretical MW: 77.3kda. Target Synonyms: RING finger protein 91Tripartite motif-containing protein 9 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human E3 ubiquitin-protein ligase TRIM9 (TRIM9) is a purified Recombinant Protein.

Accession Number

Q9C026; TRIM9

Expression Region

1-550aa

Host

E. coli

Target

E3 ubiquitin-protein ligase TRIM9 (TRIM9)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-SUMO-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of isoform 5

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

77.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

RING finger protein 91Tripartite motif-containing protein 9

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MEEMEEELKCPVCGSFYREPIILPCSHNLCQACARNILVQTPESESPQSHRAAGSGVSDYDYLDLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPPATHLSPALAPVPRNSCITCPQCHRSLILDDRGLRGFPKNRVLEGVIDRYQQSKAAALKCQLCEKAPKEATVMCEQCDVFYCDPCRLRCHPPRGPLAKHRLVPPAQGRVSRRLSPRKVSTCTDHELENHSMYCVQCKMPVCYQCLEEGKHSSHEVKALGAMWKLHKSQLSQALNGLSDRAKEAKEFLVQLRNMVQQIQENSVEFEACLVAQCDALIDALNRRKAQLLARVNKEHEHKLKVVRDQISHCTVKLRQTTGLMEYCLEVIKENDPSGFLQISDALIRRVHLTEDQWGKGTLTPRMTTDFDLSLDNSPLLQSIHQLDFVQVKASSPVPATPILQLEECCTHNNSATLSWKQPPLSTVPADGYILELDDGNGGQFREVYVGKETMCTVDGLHFNSTYNARVKAFNKTGVSPYSKTLVLQTSEGKALQQYPSERELRGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Colon
CS629818 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
Pit1 (POU1F1) (NM_000306) Human Over-expression Lysate
LC424805 20 µg

Pit1 (POU1F1) (NM_000306) Human Over-expression Lysate

Sign In for Pricing
View Details
MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (MMP3/2806), CF640R conjugate, 0.1mg/mL
BNC402806-500 1x 500 µL

MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (MMP3/2806), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
KLF13 (NM_015995) Human Over-expression Lysate
LY402483 100 µg

KLF13 (NM_015995) Human Over-expression Lysate

Sign In for Pricing
View Details
EGFR (GFR1195 + 31G7), 0.2mg/mL
BNUB1200-100 1x 100 µL

EGFR (GFR1195 + 31G7), 0.2mg/mL

Sign In for Pricing
View Details
OR2G2 Human Gene Knockout Kit (CRISPR)
KN420565 1 Kit

OR2G2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details