Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Calponin-2 (CNN2; E39A, D49A, K52A, K55A, D56A, R77A, H83A), partial

Recombinant Human Calponin-2 (CNN2; E39A, D49A, K52A, K55A, D56A, R77A, H83A), partial is a purified Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Calponin-2 (CNN2; E39A, D49A, K52A, K55A, D56A, R77A, H83A) . Accession Number: Q99439; CNN2. Expression Region: 2-133aa (E39A, D49A, K52A, K55A, D56A, R77A, H83A) . Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 21.6kda. Target Synonyms: Calponin H2; smooth muscle; Neutral calponin Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Calponin-2 (CNN2; E39A, D49A, K52A, K55A, D56A, R77A, H83A), partial is a purified Recombinant Protein.

Accession Number

Q99439; CNN2

Expression Region

2-133aa (E39A, D49A, K52A, K55A, D56A, R77A, H83A)

Host

E. coli

Target

Calponin-2 (CNN2; E39A, D49A, K52A, K55A, D56A, R77A, H83A)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>95% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

21.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Calponin H2; smooth muscle; Neutral calponin

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

SSTQFNKGPSYGLSAEVKNRLLSKYDPQKEAELRTWIAGLTGLSIGPAFQAGLAAGTILCTLMNKLQPGSVPKINASMQNWAQLENLSNFIKAMVSYGMNPVDLFEANDLFESGNMTQVQVSLLALAGKAKT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANAPC2 (Anaphase Promoting Complex Subunit 2, APC2, RP11-350O14.5) (PE)
MBS6187263-01 0.1 mL

ANAPC2 (Anaphase Promoting Complex Subunit 2, APC2, RP11-350O14.5) (PE)

Request Quote
View Details
ANAPC2 (Anaphase Promoting Complex Subunit 2, APC2, RP11-350O14.5) (PE)
MBS6187263-02 5x 0.1 mL

ANAPC2 (Anaphase Promoting Complex Subunit 2, APC2, RP11-350O14.5) (PE)

Request Quote
View Details
Lithium (metal) 99% Extrapure (coated)
01545 00100 100 g

Lithium (metal) 99% Extrapure (coated)

Request Quote
View Details
Recombinant Drosophila simulans Eukaryotic translation initiation factor 3 subunit G-2 (eIF3-S4-2)
MBS1110493-01 0.02 mg (E-Coli)

Recombinant Drosophila simulans Eukaryotic translation initiation factor 3 subunit G-2 (eIF3-S4-2)

Request Quote
View Details
Recombinant Drosophila simulans Eukaryotic translation initiation factor 3 subunit G-2 (eIF3-S4-2)
MBS1110493-02 0.02 mg (Yeast)

Recombinant Drosophila simulans Eukaryotic translation initiation factor 3 subunit G-2 (eIF3-S4-2)

Request Quote
View Details
Recombinant Drosophila simulans Eukaryotic translation initiation factor 3 subunit G-2 (eIF3-S4-2)
MBS1110493-03 0.1 mg (E-Coli)

Recombinant Drosophila simulans Eukaryotic translation initiation factor 3 subunit G-2 (eIF3-S4-2)

Request Quote
View Details