Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pyrococcus furiosus DNA/RNA-binding protein Alba (albA)

Recombinant Pyrococcus furiosus DNA/RNA-binding protein Alba (albA) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) . Target Name: DNA/RNA-binding protein Alba (albA) . Accession Number: Q8TZV1; albA. Expression Region: 1-93aa. Tag Info: N-terminal 6xHis-SUMO-tagged. Theoretical MW: 26.4kda. Target Synonyms: albA; PF1881DNA/RNA-binding protein Alba Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Pyrococcus furiosus DNA/RNA-binding protein Alba (albA) is a purified Recombinant Protein.

Accession Number

Q8TZV1; albA

Expression Region

1-93aa

Host

E. coli

Target

DNA/RNA-binding protein Alba (albA)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-SUMO-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

26.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

AlbA; PF1881DNA/RNA-binding protein Alba

Species

Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)

Protein Name

Recombinant Protein

AA Sequence

MAEEHVVYIGKKPVMNYVLAVITQFNEGAKEVSIKARGRAISRAVDVAEIVRNRFLKDTVDIKEIKIGTEELPTADGRTTNTSTIEIVLERKV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Peroxiredoxin 4 Antibody (OTI9A3) [DyLight 405]
NBP2-73338V 0.1 mL

Mouse Monoclonal Peroxiredoxin 4 Antibody (OTI9A3) [DyLight 405]

Sign In for Pricing
View Details
LOC100505147 3'UTR GFP Stable Cell Line
TU162276 1.0 mL

LOC100505147 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Rabbit Polyclonal CLPTM1 Antibody [DyLight 594]
NBP2-32114DL594 0.1 mL

Rabbit Polyclonal CLPTM1 Antibody [DyLight 594]

Sign In for Pricing
View Details
ALA hydrochloride
orb1224731-01 50 mg

ALA hydrochloride

Sign In for Pricing
View Details
ALA hydrochloride
orb1224731-02 100 mg

ALA hydrochloride

Sign In for Pricing
View Details
ALA hydrochloride
orb1224731-03 200 mg

ALA hydrochloride

Sign In for Pricing
View Details