Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-1 family member 10 (Il1f10)

Recombinant Mouse Interleukin-1 family member 10 (Il1f10) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Interleukin-1 family member 10 (Il1f10) . Accession Number: Q8R459; Il1f10. Expression Region: 1-152aa. Tag Info: N-terminal 6xHis-SUMO-tagged. Theoretical MW: 33.1kda. Target Synonyms: Il1f10Interleukin-1 family member 10; IL-1F10 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Interleukin-1 family member 10 (Il1f10) is a purified Recombinant Protein.

Accession Number

Q8R459; Il1f10

Expression Region

1-152aa

Host

E. coli

Target

Interleukin-1 family member 10 (Il1f10)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-SUMO-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

33.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Il1f10Interleukin-1 family member 10; IL-1F10

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

MCSLPMARYYIIKDAHQKALYTRNGQLLLGDPDSDNYSPEKVCILPNRGLDRSKVPIFLGMQGGSCCLACVKTREGPLLQLEDVNIEDLYKGGEQTTRFTFFQRSLGSAFRLEAAACPGWFLCGPAEPQQPVQLTKESEPSTHTEFYFEMSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (RIV9), CF640R conjugate, 0.1mg/mL
BNC400322-100 1x 100 µL

CD3e (RIV9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF405S conjugate, 0.1mg/mL
BNC040679-500 1x 500 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF488A conjugate, 0.1mg/mL
BNC880149-100 1x 100 µL

CD106 / VCAM1 (1.4C3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (45M1), CF405S conjugate, 0.1mg/mL
BNC040031-100 1x 100 µL

Mucin 5AC (MUC5AC) (45M1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF640R conjugate, 0.1mg/mL
BNC400152-100 1x 100 µL

CD11c (HC1/1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL
BNC880026-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details