Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Candida glabrata Serine/threonine-protein kinase ATG1 (ATG1), partial

Recombinant Candida glabrata Serine/threonine-protein kinase ATG1 (ATG1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata) . Target Name: Serine/threonine-protein kinase ATG1 (ATG1) . Accession Number: Q6FL58; ATG1. Expression Region: 11-312aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 38.4kda. Target Synonyms: Autophagy-related protein 1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Candida glabrata Serine/threonine-protein kinase ATG1 (ATG1), partial is a purified Recombinant Protein.

Accession Number

Q6FL58; ATG1

Expression Region

11-312aa

Host

E. coli

Target

Serine/threonine-protein kinase ATG1 (ATG1)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

38.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Autophagy-related protein 1

Species

Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)

Protein Name

Recombinant Protein

AA Sequence

YVVEKEIGKGSFATVYRGHVTTDPKSHIAVKAVARSKLKNKKLLENLEIEIAILKKIKHPHIVGLIDCERTTTDFYLVMDYCALGDLTFLIKKRKELENNHPLLQTVFNKYPPPSKEHNGLNRAFVVCYLQQLASALKFLRSKNLVHRDIKPQNLLLATPLTNYRDSKTFHELGYVGIYNLPILKIADFGFARFLPSTSLAETLCGSPLYMAPEILNYQKYNAKADLWSVGTVLFEMCCGVPPFTASNHLELFKKIKRAHDEINFPEVCEVEDGLKELICSLLTFDPAKRIGFEEFFNNKIV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sh3pxd2a (NM_001164717) Mouse Tagged Lenti ORF Clone
MR216063L4 10 µg

Sh3pxd2a (NM_001164717) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Factor Related Apoptosis Ligand (FASL)
MBS2035496-01 0.1 mL

PE-Linked Polyclonal Antibody to Factor Related Apoptosis Ligand (FASL)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Factor Related Apoptosis Ligand (FASL)
MBS2035496-02 0.2 mL

PE-Linked Polyclonal Antibody to Factor Related Apoptosis Ligand (FASL)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Factor Related Apoptosis Ligand (FASL)
MBS2035496-03 0.5 mL

PE-Linked Polyclonal Antibody to Factor Related Apoptosis Ligand (FASL)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Factor Related Apoptosis Ligand (FASL)
MBS2035496-04 1 mL

PE-Linked Polyclonal Antibody to Factor Related Apoptosis Ligand (FASL)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Factor Related Apoptosis Ligand (FASL)
MBS2035496-05 5 mL

PE-Linked Polyclonal Antibody to Factor Related Apoptosis Ligand (FASL)

Sign In for Pricing
View Details